KEGG   Mus musculus (house mouse): 18378
Entry
18378             CDS       T01002                                 
Symbol
Omp
Name
(RefSeq) olfactory marker protein
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Olfactory_mark MoaF
Other DBs
NCBI-GeneID: 18378
NCBI-ProteinID: NP_035140
MGI: 97436
Ensembl: ENSMUSG00000074006
Position
7:complement(97792566..97794654)
AA seq 163 aa
MAEDGPQKQQLEMPLVLDQDLTQQMRLRVESLKQRGEKKQDGEKLIRPAESVYRLDFIQQ
QKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEA
DALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcagaggatgggccgcagaagcagcagctggagatgccgctggttctggaccaggac
ctgacccagcagatgcggctccgagtagagagcctgaagcagcgtggggagaagaagcag
gatggtgagaagctgatccggccggctgagtccgtctaccgcctcgatttcatccagcag
cagaagctgcagttcgatcactggaacgtggttctggacaagcccggcaaggtcaccatc
acgggcacctcgcagaactggacgcccgacctcaccaacctcatgacacgccagctgctg
gaccccgccgccatcttctggcgcaaggaagactccgacgccatggattggaatgaggca
gacgccctggagtttggggagcgcctttctgatctggccaagatccgcaaggtcatgtat
ttcctcatcacctttggcgagggcgtggagcctgccaacctaaaggcctctgtggtgttt
aaccagctctga

DBGET integrated database retrieval system