KEGG   Mus musculus (mouse): 18378
Entry
18378             CDS       T01002                                 

Gene name
Omp
Definition
(RefSeq) olfactory marker protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Olfactory_mark MoaF
Other DBs
NCBI-GeneID: 18378
NCBI-ProteinID: NP_035140
MGI: 97436
Ensembl: ENSMUSG00000074006
Vega: OTTMUSG00000022533
UniProt: Q64288 A2RT14
Structure
PDB: 
1F35 1JOB 1JOD

Position
7 E1; 7 53.59 cM
AA seq 163 aa
MAEDGPQKQQLEMPLVLDQDLTQQMRLRVESLKQRGEKKQDGEKLIRPAESVYRLDFIQQ
QKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEA
DALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcagaggatgggccgcagaagcagcagctggagatgccgctggttctggaccaggac
ctgacccagcagatgcggctccgagtagagagcctgaagcagcgtggggagaagaagcag
gatggtgagaagctgatccggccggctgagtccgtctaccgcctcgatttcatccagcag
cagaagctgcagttcgatcactggaacgtggttctggacaagcccggcaaggtcaccatc
acgggcacctcgcagaactggacgcccgacctcaccaacctcatgacacgccagctgctg
gaccccgccgccatcttctggcgcaaggaagactccgacgccatggattggaatgaggca
gacgccctggagtttggggagcgcctttctgatctggccaagatccgcaaggtcatgtat
ttcctcatcacctttggcgagggcgtggagcctgccaacctaaaggcctctgtggtgttt
aaccagctctga

DBGET integrated database retrieval system