KEGG   Mus musculus (mouse): 18386Help
Entry
18386             CDS       T01002                                 

Gene name
Oprd1, DOR, DOR-1, Nbor, mDOR
Definition
(RefSeq) opioid receptor, delta 1
  KO
K04213  delta-type opioid receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    18386 (Oprd1)
   04022 cGMP-PKG signaling pathway
    18386 (Oprd1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    18386 (Oprd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    18386 (Oprd1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Opioid
    18386 (Oprd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 18386
NCBI-ProteinID: NP_038650
MGI: 97438
Ensembl: ENSMUSG00000050511
Vega: OTTMUSG00000010973
UniProt: P32300 A2AD37 Q8BLP9
Position
4 D2.3; 4 64.78 cM
AA seq 372 aa AA seqDB search
MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTAC
TPSDGPGGGAAA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggagctggtgccctctgcccgtgcggagctgcagtcctcgcccctcgtcaacctctcg
gacgcctttcccagcgccttccccagcgcgggcgccaatgcgtcggggtcgccgggagcc
cgtagtgcctcgtccctcgccctagccatcgccatcaccgcgctctactcggctgtgtgc
gcagtggggcttctgggcaacgtgctcgtcatgtttggcatcgtccggtacaccaaattg
aagaccgccaccaacatctacatcttcaatctggctttggctgatgcgctggccaccagc
acgctgcccttccagagcgccaagtacttgatggaaacgtggccgtttggcgagctgctg
tgcaaggctgtgctctccattgactactacaacatgttcactagcatcttcaccctcacc
atgatgagcgtggaccgctacattgctgtctgccatcctgtcaaagccctggacttccgg
acaccagccaaggccaagctgatcaatatatgcatctgggtcttggcttcaggtgtcggg
gtccccatcatggtcatggcagtgacccaaccccgggatggtgcagtggtatgcatgctc
cagttccccagtcccagctggtactgggacactgtgaccaagatctgcgtgttcctcttt
gccttcgtggtgccgatcctcatcatcacggtgtgctatggcctcatgctactgcgcctg
cgcagcgtgcgtctgctgtccggttccaaggagaaggaccgcagcctgcggcgcatcacg
cgcatggtgctggtggtggtgggcgccttcgtggtgtgctgggcgcccatccacatcttc
gtcatcgtctggacgctggtggacatcaatcggcgcgacccacttgtggtggccgcactg
cacctgtgcattgcgctgggctacgccaacagcagcctcaacccggttctctacgccttc
ctggacgagaacttcaagcgctgcttccgccagctctgtcgcacgccctgcggccgccaa
gaacccggcagtctccgtcgtccccgccaggccaccacgcgtgagcgtgtcactgcctgc
accccctccgacggcccgggcggtggcgctgccgcctga

DBGET integrated database retrieval system