KEGG   Mus musculus (mouse): 18387
Entry
18387             CDS       T01002                                 

Gene name
Oprk1, K-OR-1, KOR, KOR-1, MSL-1, Op, Oprk2, R2, R21
Definition
(RefSeq) opioid receptor, kappa 1
  KO
K04214  kappa-type opioid receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    18387 (Oprk1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    18387 (Oprk1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Opioid
    18387 (Oprk1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 18387
NCBI-ProteinID: NP_001191300
MGI: 97439
Ensembl: ENSMUSG00000025905
Vega: OTTMUSG00000034734
UniProt: P33534 Q14AL5 Q3UVW8
Position
1 A1; 1 1.89 cM
AA seq 380 aa
MESPIQIFRGDPGPTCSPSACLLPNSSSWFPNWAESDSNGSVGSEDQQLESAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSAVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLASSVGISAIVLGGTKVREDVDVIECSLQFPDDEYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITKLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPVLYAFLDENFKRCFRDFCFPIKMRMERQSTNRV
RNTVQDPASMRDVGGMNKPV
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggagtcccccattcagatcttccgaggagatccaggccctacctgctctcccagtgct
tgccttctccccaacagcagctcttggttccccaactgggcagaatccgacagtaatggc
agtgtgggctcagaggatcagcagctggagtccgcgcacatctctccggccatccctgtt
atcatcaccgctgtctactctgtggtatttgtggtgggcttagtgggcaattctctggtc
atgtttgtcatcatccgatacacgaagatgaagaccgcaaccaacatctacatatttaac
ctggctttggcagatgctttggttactaccactatgccctttcagagtgctgtctacttg
atgaattcttggccttttggagatgtgctatgcaagattgtcatttccattgactactac
aacatgtttaccagcatattcaccttgaccatgatgagtgtggaccgctacattgctgtg
tgccaccctgtgaaagctttggacttccgaacacctttgaaagcaaagatcatcaacatc
tgcatttggctcctggcatcatctgttggtatatcagcgatagtccttggaggcaccaaa
gtcagggaagatgtggatgtcattgaatgctccttgcagtttcctgatgatgaatattcc
tggtgggatctcttcatgaagatctgtgtcttcgtctttgcctttgtgatcccagtcctc
atcatcattgtctgctacaccctgatgatcctgcgcctgaagagtgtccggctcctgtct
ggctcccgagagaaggaccgaaatctccgccgcatcaccaagctggtgctggtagtagtt
gcagtcttcatcatctgttggacccccattcacatctttatcctggtggaggctctggga
agcacctcccacagcacagctgccctctccagctattatttctgtattgccttgggttat
accaacagcagcctgaatcctgttctctatgcctttctggatgaaaacttcaagcggtgt
tttagggacttctgcttccctattaagatgcgaatggagcgccagagcaccaatagagtt
agaaacacagttcaggatcctgcttccatgagagatgtgggagggatgaataagccagta
tga

DBGET integrated database retrieval system