KEGG   Mus musculus (house mouse): 18392
Entry
18392             CDS       T01002                                 
Symbol
Orc1, MmORC1, Orc1l
Name
(RefSeq) origin recognition complex, subunit 1
  KO
K02603  origin recognition complex subunit 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    18392 (Orc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    18392 (Orc1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    18392 (Orc1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    18392 (Orc1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     18392 (Orc1)
SSDB
Motif
Pfam: Cdc6_C AAA BAH AAA_22 AAA_16 AAA_lid_10 AAA_30 TniB AAA_19 DUF2075 NACHT NB-ARC SpoU_methylas_C AAA_11
Other DBs
NCBI-GeneID: 18392
NCBI-ProteinID: NP_035145
MGI: 1328337
Ensembl: ENSMUSG00000028587
UniProt: Q9Z1N2 Q3TPY7 Q3UR71
Structure
Position
4:108436651..108472030
AA seq 840 aa
MPSYLTRQKTRQTFSWVGRPLPNRKQFQQMYREICMKINDGSEIHIKVGQFVLIQGEDNK
KPYVAKLIELFQNGAEVPPKKCARVQWFVRFLEIPVSKRHLLGRSPPAQEIFWYDCSDWD
NKINVETIIGPVQVVALAPEEVIPVDQKSEETLFVKLSWNKKDFAPLPPEVLAALREQED
SPEWQKPLKAKIKNVKSPARNTTEQEVKGIKSNHSTSKFHQTPANIVIPNAKKSLELDGL
GFTRKPNTRWSKKSSCDSLDYQKTSKRRAAFSETTSPPKKPNKPREIKPSSALETRVKNG
QTQPFCAKSSVVLRARNPAMTTTKLGVDNTLSPIRNGLRSSVVPSGGLTPVYIRRKAKEQ
ETHKEPIRTSRVHRKSSLLTLKRIRQQLCLLDGDDRDQEEEESVDSESEEEDEFISSLPT
RNSLGQSRTRQTPSKSPQKNPKPRTPHRATPQIRDRNLAVQEPASALEEARLRLHVSAVP
DSLPCREQEFQDIYSFVESKLLDGTGGCMYISGVPGTGKTATVHEVIRCLQQAAETDDVP
PFQYVEVNGMKLTEPHQVYVQILKKLTGQKATANHAAELLAKQFCGQGSQKETTVLLVDE
LDLLWTHKQDVMYNLFDWPTHKGAHLIVLTIANTMDLPERIMMNRVSSRLGLTRMSFQPY
SHSQLKQILVSRLRNLRAFEDDAIQLVARKVAALSGDARRCLDICRRATEICELSHLRGD
SLSLVTVAHLMEAIDEMFSSSYITAIKNSSVVEQSFLRAIIAEFRRSGLEEATFQQIYSQ
HVALCRMEGLPYPTMSETMAVCSRLGSCRLLLVEPSRNDLLLRVRLNVSQNDVLFALKEE
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgccatcctacctcacaaggcagaagaccagacaaactttctcatgggttggcaggcca
ttgccgaatcgaaaacagttccaacaaatgtacagagaaatttgtatgaaaatcaatgat
ggttctgagattcacatcaaggttggacagtttgtattgattcagggggaagataataaa
aagccctatgtggctaaactgattgaattatttcaaaatggagctgaagttcctcccaag
aaatgtgcacgagtacagtggtttgtcagattccttgagattcctgtctctaaaaggcac
ttgttaggccgcagtcctcctgcacaggagatattctggtatgactgttctgactgggat
aacaagattaatgtggagaccatcattggccctgttcaggtagtggcattagccccagaa
gaagtgattcctgtggatcagaaaagtgaggagacactgtttgtgaagctatcctggaat
aaaaaggactttgcaccactgccaccagaagtgcttgcagcattaagggaacaagaagat
agtcctgagtggcaaaaacctttaaaagccaagattaagaatgtaaaaagccctgcccgg
aacacaacagaacaagaggtcaaagggatcaaatcaaatcattccacttccaaatttcac
cagactcctgctaatattgtcatccccaatgcaaagaagtcgctggaactcgatggctta
ggttttaccaggaagcctaacacgaggtggtcaaagaagagctcgtgtgactccttggat
tatcaaaaaacatctaaaagaagagcagccttctctgagaccacctcgcctcctaaaaag
cctaataaacctcgtgaaatcaagccctcttcagctttggaaactcgagttaaaaatgga
caaactcaacctttttgtgccaaaagtagtgtggttctgagagcccggaacccagctatg
acgaccacaaagcttggtgtggacaacacacttagccctatcaggaatgggttgagatct
tcagtggtgccctctgggggtctgacaccagtatacattaggaggaaggcaaaagaacaa
gaaactcacaaagaacccatccgtacttctcgtgtccatagaaagagttctctcttgact
ttgaagcggattaggcaacagctttgtcttctagatggtgatgacagggaccaagaagag
gaagagtccgtagactctgagagtgaggaggaagatgagtttatttcctccctcccaaca
agaaattccctggggcagtccaggacccggcagaccccctccaagtcaccacagaaaaat
cctaaacctagaacacctcatcgtgccactcctcagatccgagacagaaacctggctgtc
caggagccagctagtgcgctggaagaggcacggctgaggttgcatgtttctgctgtgcct
gactctctcccctgtcgagagcaggaattccaagacatctacagctttgtggaaagtaaa
cttcttgatgggactggagggtgtatgtacatttctggggtccctgggacagggaagaca
gccactgtgcatgaggtcatacgctgtctgcagcaggcagcagaaacagatgatgttcct
ccctttcaatatgttgaggttaatgggatgaagctgacagaaccccaccaagtctatgtg
cagattttaaagaaactgacaggccagaaggcaacagccaatcatgcagcagaactgctg
gcgaagcaattctgtggccaagggtcccagaaggaaaccactgtactgctcgtggatgag
cttgaccttctttggactcacaaacaagatgtaatgtacaacctctttgattggcctact
cacaaaggggcccacttgatagtgctgaccattgccaacaccatggaccttcccgagagg
atcatgatgaaccgtgtgtctagccgactgggcctcaccaggatgtctttccagccctat
tctcacagccagctgaaacagatcttagtgtctcgactgaggaatttaagggcctttgag
gacgatgccatccagctggtggccaggaaggtagcagccctctctggagatgcccggcgc
tgcctggacatctgcaggcgtgccacggagatctgcgagctttcccatctacgcggtgac
tctctgagcctggtgactgtggcccacttaatggaagctatagatgaaatgttctcctcg
tcatatattactgccatcaaaaactcttctgtcgtggaacagagcttcctgagagccatt
attgcggaattccgtcggtcaggactagaggaagcaacctttcaacagatatacagtcag
cacgtggctctgtgccgaatggagggactgccatacccaaccatgtcagagaccatggct
gtgtgctcacgtctgggttcttgccgcctccttctggtggagcccagtagaaatgacctc
ctccttcgagtgagactcaatgttagccagaatgacgtgctgtttgctctcaaagaagag
tga

DBGET integrated database retrieval system