KEGG   Mus musculus (mouse): 18399Help
Entry
18399             CDS       T01002                                 

Gene name
Slc22a6, NKT, Oat1, Orctl1, mOat1
Definition
(RefSeq) solute carrier family 22 (organic anion transporter), member 6
  KO
K08203  MFS transporter, OCT family, solute carrier family 22 (organic anion transporter), member 6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    18399 (Slc22a6)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   18399 (Slc22a6)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    18399 (Slc22a6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 VIT1
Motif
Other DBs
NCBI-GeneID: 18399
NCBI-ProteinID: NP_032792
MGI: 892001
Ensembl: ENSMUSG00000024650
UniProt: Q8VC69
Position
19 A; 19 5.44 cM
AA seq 545 aa AA seqDB search
MAFNDLLKQVGGVGRFQLIQVTMVVAPLLLMASHNTLQNFTAAIPAHHCRPPANANLSKD
GGLEAWLPLDKQGRPESCLRFPFPHNGTEANGTGVTEPCLDGWVYDNSTFPSTIVTEWNL
VCSHRAFRQLAQSLFMVGVLLGAMMFGYLADRLGRRKVLILNYLQTAVSGTCAAYAPNYT
VYCIFRLLSGMSLASIAINCMTLNMEWMPIHTRAYVGTLIGYVYSLGQFLLAGIAYAVPH
WRHLQLAVSVPFFVAFIYSWFFIESARWYSSSGRLDLTLRALQRVARINGKQEEGAKLSI
EVLQTSLQKELTLNKGQASAMELLRCPTLRRLFLCLSMLWFATSFAYYGLVMDLQGFGVS
MYLIQVIFGAVDLPAKFVCFLVINSMGRRPAQLASLLLAGICILVNGIIPRGHTIIRTSL
AVLGKGCLASSFNCIFLYTGELYPTMIRQTGLGMGSTMARVGSIVSPLISMTAEFYPSIP
LFIFGAVPVAASAVTALLPETLGQPLPDTVQDLKSRSRGKQKQQQLEQQKQMIPLQVSTQ
EKNGL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggccttcaatgacctcctgaaacaggtggggggtgtcggacgcttccagctgatccag
gtcaccatggtggttgctcccctactgctgatggcttcccacaacaccctgcagaacttc
actgctgctatccccgctcaccactgccgcccacctgctaatgccaacctcagcaaagat
ggaggtctggaggcctggctgcccctggacaagcaaggacgacccgaatcttgcctccgc
tttcctttcccgcacaatggcacagaggccaatggcaccggagtcacagagccctgcctt
gatggctgggtctatgacaacagcaccttcccttcaaccatcgtgactgagtggaacctt
gtgtgctctcatcgggccttccgccagctggcccagtccctgttcatggtgggagtgtta
ctgggagccatgatgtttggctacctggcggacaggctgggccgtcggaaggtgctgatc
ttgaactacctgcaaacagctgtgtcgggaacctgtgcagcctatgcacccaactatact
gtctactgcattttccggctcctctcgggcatgtctttggctagcattgcaatcaactgc
atgacactaaacatggagtggatgcctattcacacccgtgcctatgtgggcaccttgatt
ggctatgtctacagcttgggccagttcctcctggctggtatcgcctatgctgtgccccac
tggcgccacctgcagcttgcggtctctgtgccttttttcgttgccttcatctactcttgg
ttcttcattgagtcagcccgctggtactcctcctctggaaggctggacctcaccctccga
gccctgcagagagtggcccgcatcaacgggaaacaagaagagggggctaagctgagtata
gaggtgctccagaccagcctgcagaaggaactgactctaaacaaaggccaggcctccgcc
atggagctgctgcgctgccccacgcttcggcgcctcttcctctgcctctctatgctgtgg
tttgccactagctttgcctactacgggctggtcatggacctgcagggctttggggtcagc
atgtaccttatccaggtgattttcggcgctgtggacctgcctgccaagtttgtgtgcttc
ctagtcatcaattccatgggccgccggcctgcacagttggcctccctgctgctggcaggc
atctgtatcctagtgaatggcataataccgaggggccatacaatcattcgcacatccctg
gctgtactagggaaaggctgtctggcttcctctttcaactgcatcttcctgtacaccgga
gagctgtaccccacaatgattcggcagacgggcctgggcatgggcagcaccatggcccgg
gtgggcagcatagtgagcccactgataagcatgactgccgagttctacccctccatacct
ctcttcatcttcggcgctgtccccgtggccgccagcgctgtcactgccctgctgccagag
accttgggccagccgctgcctgatacagtgcaggacctgaagagcaggagcagaggaaag
cagaagcaacagcagctggaacagcagaagcagatgataccactccaggtctcaacacaa
gagaagaacggactctga

DBGET integrated database retrieval system