KEGG   Mus musculus (mouse): 18405Help
Entry
18405             CDS       T01002                                 

Gene name
Orm1, Agp-1, Agp-2, Orm-1
Definition
(RefSeq) orosomucoid 1
  KO
K17308  alpha-1-acid glycoprotein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    18405 (Orm1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   18405 (Orm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin LRR_5 Virulence_fact
Motif
Other DBs
NCBI-GeneID: 18405
NCBI-ProteinID: NP_032794
MGI: 97443
Ensembl: ENSMUSG00000039196
Vega: OTTMUSG00000000305
UniProt: Q60590
Position
4 B3; 4 33.96 cM
AA seq 207 aa AA seqDB search
MALHTVLIILSLLPMLEAQNPEHANFTIGEPITNETLSWLSDKWFFMGAAFRKLEYRQAI
QTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQRENGTFSKYEGGVETFAHL
IVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELREVFQKAVTHVGMDESEIIFVDWK
KDRCGQQEKKQLELGKETKKDPEEGQA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcacacggttcttatcatattgagccttctgccgatgttggaagctcagaac
ccagaacatgccaacttcaccataggcgaacctatcaccaatgagaccctgagctggctc
tctgacaaatggtttttcatgggtgcagctttcagaaaactcgagtacaggcaggcaatt
caaacaatgcagagtgaatttttttaccttaccaccaacttgataaacgacacaatagag
cttcgggagtctcaaacaataggtgaccagtgtgtctataactccacccatctaggattc
cagagagaaaatgggaccttctccaagtatgaaggaggagtagaaacctttgcccacctt
atagtgctgaggaaacatggggccttcatgcttgcctttgacctcaaggatgagaagaaa
cggggactgtccctctatgccaaaaggccagatatcaccccggagctgcgggaagtattc
cagaaggctgtcacacacgtgggcatggatgaatcagaaatcatatttgtcgactggaaa
aaggataggtgcggtcagcaggagaagaagcagcttgagttggggaaggagaccaagaaa
gatcctgaggaaggccaggcatga

DBGET integrated database retrieval system