KEGG   Mus musculus (mouse): 18412
Entry
18412             CDS       T01002                                 

Gene name
Sqstm1, A17, A170, OSF, OSF-6, Osi, S, STAP, STONE14, p6, p62
Definition
(RefSeq) sequestosome 1
  KO
K14381  sequestosome 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04217  Necroptosis
mmu04218  Cellular senescence
mmu04380  Osteoclast differentiation
mmu05014  Amyotrophic lateral sclerosis
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    18412 (Sqstm1)
   04137 Mitophagy - animal
    18412 (Sqstm1)
  09143 Cell growth and death
   04217 Necroptosis
    18412 (Sqstm1)
   04218 Cellular senescence
    18412 (Sqstm1)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    18412 (Sqstm1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    18412 (Sqstm1)
   05022 Pathways of neurodegeneration - multiple diseases
    18412 (Sqstm1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18412 (Sqstm1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18412 (Sqstm1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    18412 (Sqstm1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    18412 (Sqstm1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Mitophagy
   Cargo receptors
    18412 (Sqstm1)
  Pexophagy
    18412 (Sqstm1)
  Aggrephagy
    18412 (Sqstm1)
  Xenophagy
    18412 (Sqstm1)
  Other autophagy associated proteins
   Midbophagy associated proteins
    18412 (Sqstm1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    18412 (Sqstm1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   18412 (Sqstm1)
SSDB
Motif
Pfam: UBA_5 PB1 ZZ C1_2
Other DBs
NCBI-GeneID: 18412
NCBI-ProteinID: NP_035148
MGI: 107931
Ensembl: ENSMUSG00000015837
Vega: OTTMUSG00000005574
UniProt: Q64337
Structure
PDB: 
3B0F 2RRU

Position
11; 11 B1.3
AA seq 442 aa
MASFTVKAYLLGKEEATREIRRFSFCFSPEPEAEAQAAAGPGPCERLLSRVAVLFPTLRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRREHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHREHSKLIFPNPFGHLSDSFS
HSRWLRKLKHGHFGWPGWEMGPPGNWSPRPPRAGDGRPCPTAESASAPPEDPNVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPTTPESSSTGTEDKSNTQPSSCSSEVSKPDG
AGEGPAQSLTEQMKKIALESVGQPEEQMESGNCSGGDDDWTHLSSKEVDPSTGELQSLQM
PESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQ
TKNYDIGAALDTIQYSKHPPPL
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggcgtcgttcacggtgaaggcctatcttctgggcaaggaggaggcgacccgcgagatc
cgccgcttcagcttctgcttcagcccggagccggaggcggaagcccaagccgcggccggc
ccggggccctgcgagaggctgctgagccgagtggctgtgctgttccccacgctgaggcct
ggcggcttccaggcgcactaccgcgatgaggatggggacttggttgccttttccagtgat
gaggagctgacaatggctatgtcctatgtgaaagatgacatcttccgcatctacattaaa
gagaagaaggagtgccggcgggaacatcgcccaccatgtgctcaggaggcaccccgaaac
atggtgcaccccaatgtgatctgtgatggttgcaacgggcctgtggtgggaactcgctat
aagtgcagtgtgtgcccagactacgacctgtgcagcgtgtgcgaggggaagggcctgcac
agggaacacagcaagctcatctttcccaacccctttggccacctctctgatagcttctct
catagccgctggcttcggaagctgaaacatggacactttggctggcctggctgggagatg
ggcccaccggggaactggagcccacgtcctcctcgtgcaggggatggccgcccttgccct
acagctgagtcagcttctgctccaccagaagatcccaatgtcaatttcctgaagaatgtg
ggggagagtgtggcagctgccctcagccctctaggcattgaggttgacattgatgtggaa
catggagggaagagaagccgcctgacacccactaccccagaaagttccagcacaggcaca
gaagacaagagtaacactcagccaagcagctgctcttcggaagtcagcaaacctgacggg
gctggggagggccctgctcagtctctgacagagcaaatgaaaaagatagccttggagtcg
gtgggacagccagaggaacagatggagtcgggaaactgctcaggaggagacgatgactgg
acacatttgtcttcaaaagaagtggacccatctacaggtgaactccagtctctacagatg
ccagaatcggaagggccaagctctctagacccctcacaggaaggacccacagggctgaag
gaagctgccctatacccacatctcccaccagaggctgatccccggctgattgagtccctc
tcccagatgctgtccatgggtttctcggatgaaggcggctggctcaccaggctcctacag
accaagaattacgacatcggggctgctctggacacgatccagtattcgaagcaccctcca
ccattgtga

DBGET integrated database retrieval system