KEGG   Mus musculus (mouse): 18416
Entry
18416             CDS       T01002                                 

Gene name
Otc, AI265390, Sf, spf
Definition
(RefSeq) ornithine transcarbamylase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00220  Arginine biosynthesis
mmu01100  Metabolic pathways
mmu01230  Biosynthesis of amino acids
Module
mmu_M00029  Urea cycle
mmu_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    18416 (Otc)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     18416 (Otc)
SSDB
Motif
Pfam: OTCace OTCace_N
Other DBs
NCBI-GeneID: 18416
NCBI-ProteinID: NP_032795
MGI: 97448
Ensembl: ENSMUSG00000031173
Vega: OTTMUSG00000016913
UniProt: P11725 Q543H3
Position
X A1.1; X 4.66 cM
AA seq 354 aa
MLSNLRILLNNAALRKGHTSVVRHFWCGKPVQSQVQLKGRDLLTLKNFTGEEIQYMLWLS
ADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPSFLTTQDIHLGV
NESLTDTARVLSSMTDAVLARVYKQSDLDTLAKEASIPIVNGLSDLYHPIQILADYLTLQ
EHYGSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDPNIVKLAEQYAKEN
GTKLSMTNDPLEAARGGNVLITDTWISMGQEDEKKKRLQAFQGYQVTMKTAKVAASDWTF
LHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPVLQKPKF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgctgtctaatttgaggatcctgctcaacaatgcagctcttagaaagggtcacacttct
gtggttcgacatttttggtgtgggaagccagtccaaagtcaagtacagctgaaaggccgt
gacctcctcaccttgaagaacttcacaggagaggagattcagtacatgctatggctctct
gcagatctgaaattcaggatcaagcagaaaggagaatatttacctttattgcaagggaaa
tccttaggaatgatttttgagaaaagaagtactcgaacaagactgtccacagaaacaggc
tttgctctgctgggaggacacccttcctttcttaccacacaagacattcacttgggtgtg
aatgaaagtctcacagacaccgctcgtgtcttatctagcatgacagatgcagtgttagct
cgagtgtataaacaatcagatctggacaccctggctaaagaagcatccatcccaattgtc
aatggactgtcagacttgtatcatcctatccagatcctggctgattaccttacactccag
gaacactatggctctctcaaaggtcttaccctcagctggataggggatgggaacaatatc
ttgcactctatcatgatgagtgctgcaaaattcgggatgcaccttcaagcagctactcca
aagggttatgagccagatcctaatatagtcaagctagcagagcagtatgccaaggagaat
ggtaccaagttgtcaatgacaaatgatccactggaagcagcacgtggaggcaatgtatta
attacagatacttggataagcatgggacaagaggatgagaagaaaaagcgtcttcaagct
ttccaaggttaccaggttacgatgaagactgccaaagtggctgcgtctgactggacattt
ttacactgtttgcctagaaagccagaagaagtggatgatgaagtattttattctccacgg
tcattagtgttcccagaggcagagaatagaaagtggacaatcatggctgtcatggtatcc
ctgctgacagactactcacctgtgctccagaagccaaagttttga

DBGET integrated database retrieval system