KEGG   Mus musculus (mouse): 18419
Entry
18419             CDS       T01002                                 

Gene name
Otog, 4932420K09, Otgn, twt
Definition
(RefSeq) otogelin
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: VWD C8 TIL AbfB VWC
Other DBs
NCBI-GeneID: 18419
NCBI-ProteinID: NP_038652
MGI: 1202064
Ensembl: ENSMUSG00000009487
Vega: OTTMUSG00000058656
UniProt: O55225
Position
7 B3; 7 29.66 cM
AA seq 2911 aa
MGARMPRRCLLLLSCFCLLRVESTAEVQHQASALTWKISAELQQEPAPEPSHTYQEMSLA
VEDVTTVMEGQEAEALAASAMSSWERRLHRAKCAPSYLFSCFNGGECVHPALCDCRRFNA
TGPRCQLVYNVGPERDSICRTWGQHHVETFDGLYYYFSGKGSYTLVGHHEPEGQSFSIQV
HNDPQCGSAHYTCPRSVSLFLSGEREICLAKEVTHGGVRVQLPQVVGGVQLQQLAGYVIA
RHPSAFTLAWDGISAIYIKMSPEFLGWTHGLCGNNNADPQDDLVTSYGKVTDDVGEFVHS
WQEQVPNSPPGPVTTSLPRPPCLQQSPASMQGVYERCEVLLRPPFDTCHAYVSPLPFAAS
CTSDLCQSGGDEATWCRALMEYARACAQAGRPLQGWRTQLSQCTVHCKEKAFIYNECIAC
CPASCQSRASCVDSEITCVDGCYCPNGLIFEDGGCMSPAECPCEFHGTLHPPGSVVTEDC
NACTCTAGKWVCSSSVCPAECSVTGDIHFTTFDGRRYTFPATCQYILAKSRSSGTFTVTL
QNAPCGLNQDGACVQSVSVILHQDPRRQVTLTQAGDVLLFDQYKITPPYSDDAFEIRRLS
SVFLRVRTNVGVRILYDREGLRLYLQVDQRWVEDTVGLCGTFNGNTQDDFLSPVGVPEST
PQLFGNSWKTLSACVPLVPGSLLDPCDVHLQAASYALQSCSVLTGELFAPCSAYLSPIPY
FEQCRRDACRCGQPCLCATLAHYARLCRRHGLPVDFRAHLPACALSCEATKEYSPCVTLC
APTCQDLASPDVCGANGGGNFSREECVEGCTCPPDTFLDTQADLCVPRNQCSCHFQGVDY
PPGDSDIPSLGHCHCKDGVMSCDSRAPAAACPAGQVFVNCSELHPDPELSRERTCEQQLL
NLSVPARGPCLSGCACPQGLLRHGDACFPPEECPCTWKGKEYFPGDQVVSSCHTCVCQRG
SFQCTLHPCASTCTAYGDRHYRTFDGLPYDFVGACKVHLVKSTSELSFSVMVEDVNCYGS
GVICRKSISINVGSSLIIFDDDSGDPSPESFLDEKQAVHIWRAGFFTLVHFPREHITLLW
DQRTTVHVQAGPQWQGQLVGLCGNFDLKTINEMRTPENLELTNPQEFGSSWAAVECPDTP
DPRDTCVLNPLREPFARKECGILLSEVFETCHPVVDVTWFYSNCLTDTCGCSRGGDCECF
CASVAAYAHQCCQHGVVIDWRTPRICPYDCDFFNKALGKGPYQLSSVAAGGTLVATKAVD
SDIALVRAEDLAPGDISSFLLTAALYKAKAHDPDVVSLEAADRPNFFLHTTANGSIGLAK
WQRDEAFHQHASFSLHRGTWQAGLVALESLAKPGSFLHSSGLELALRAYEHTEVFRGGAL
FRLLDAKPLGAAYPTCEWRYDACASPCFQTCRDPRATSCQDVPRVEGCVPVCPTPKVLDE
VTQRCVYLEDCVEPAPRGPTETLGNETLVPGQVPPTTSAEQQLPQGLPGASAYSPAPVPV
APPTSAPNPPMAATEGQAPSPGSTQPTLQTPLGLTTSNFPAGHTEATAREEGAASLLTTS
HPPGFSSSLPSSLQMPTSGIVSGATETTKVTITFTGSPNTTVASRSPPIPRFPLMTKAVT
VPSHDSFPVKTTPLQPSWLWSLSSRPMTSLGATSWPPTSPGSHLSTAVTKVANKTMTSLS
VLAQSTSSSSQPLAAVTTAHRAPASPLVTKGLEVVSATEKGEAGHSQLTELPVSPPPSPA
PIDLPHPAQHTTTAPGPSALSPGILAAGSPSTGAHRPGATALASLEPTRPPHLLSGLPLD
TSLPLAKVGTSAPVATPGSKGYIPTPPPQHQATTLATAMTVSPLTQSLSLTVPLMSAVEE
QAHSPSPKPPQGTGMAPDQMLGATLPSFGASSVIAGVPPTVSAAPRKSTTQRAAILSKKV
SPPTLISDSVQGGFTELTPIVSHTVTPLATEAEGPRAGTVPLVPTTYSLSRVSARTASRE
GPLVLLPQLAEAYGTPAGLQPQEDLVRQATTEQSGRSAPAKSIAEESMEAEVNTSATCVP
IAEQDCVRHICLEGQLIRVNQTQHCPQGAVRPRCGVLGLAVRVGGDRCCPQWECACRCSI
FPDLSFVTFDGSHAALFKEAIYVLSQSPDETISVHVLDCKSANLGHLNWPPFCLVILNVT
HLAHHVSIDRFNRKVTVDSQVVWPPMSRYGFRIEDTGHMYIVRTPSHIQIQWLHSSGLMI
LEASKVSKTQGHGLCGICDGDAANDLTLKDGSVLGEAEDPAPFLDSWQVPSSLTSEGQTR
FRPDSCATADCSPCLRMVSNRTFSACHSFVSPESFCELWIRDTKYVQQPCVALTVYVAMC
HKFHVCIEWRGSDYCPFLCSSDSTYQACVAACEPPDTCQDGILGPLDPEQCQVLGEGCVC
TEGTILHRRHSALCIPEDKCACTDSTGVPRALGETWNSSLSGCCQQQCQAPDTIIPVDLD
CPGPRPESCPRFGEVILLQPTEDPCCLGSVCVCNQTLCEGLAPTCRPGHSLITHFQEDSC
CPSYSCECDPGLCEAEQVPTCREDQILIEGRLGDSCCTSYFCGCGECSDPMPECQEGEAL
TVHRNTTELCCPLYQCVCENFRCPQVQCGMGTSLVEVWSPDRCCPYKSCECDCDTIPVPR
CHLWEKSQLDEEFMHSVENVCGCAKYECVKAPVCLSRELGVMQPGQTVVELSADGVCHTS
RCTDVLDPLTNFYQINITSVLCDMHCEANQEYDHPRDLAACCGSCRNVSCLFTFPNGTTS
LFLPGASWIADCARHHCGSTPLGAVLVRSPISCPPFNETECAKVGGSVVPSLEGCCRACK
EDGRSCKKVTIRMTIRKNDCRSNTPVNLVSCDGRCPSASIYNHNINTYARFCKCCREVGL
QRRSVQLFCATNATWVPYTVQEPTDCACQWS
NT seq 8736 nt   +upstreamnt  +downstreamnt
atgggagcccgcatgcccagacgatgcttgcttcttctctcttgcttttgtctacttagg
gttgagtccactgcagaggtgcagcaccaggcctcagcactcacatggaaaatcagtgca
gagctgcaacaggagcctgctcctgagcccagccacacataccaggagatgtcccttgca
gtggaggatgtcacaacagttatggaaggccaggaggctgaagccttagccgcatcggcc
atgtcttcgtgggaaagacggctccatcgcgccaagtgtgcaccgtcgtacttgttctcc
tgcttcaatgggggtgagtgtgtgcacccagctctctgtgactgcaggcgcttcaatgcc
actggaccccgttgccagttggtgtataatgtaggtcctgagcgggacagcatctgccgg
acctgggggcagcaccacgtggagacgtttgacggcctgtactactacttttctggaaag
ggcagctacacgctggtgggacaccacgaacccgagggtcagagtttttccatccaggtg
cacaatgacccacagtgtggctctgcccactacacctgcccgaggtctgtcagcctcttc
ctctcaggtgaacgtgagatctgcctggccaaggaagtcacccatggaggtgtaagggtc
cagctgccgcaggtggtggggggtgtgcagctgcagcagctggctggttacgtcatcgcg
aggcatccgtcagccttcaccctggcctgggatggtatctcagccatttacatcaagatg
agccctgagtttctgggctggacccatgggctgtgtgggaacaacaatgctgaccctcag
gatgacctggtgaccagttacgggaaggtgactgatgatgtaggggagtttgtacacagc
tggcaggagcaggtccccaacagccctccaggacctgtgactacttccctgcctcgccca
ccatgcctgcagcagagcccagcatccatgcagggtgtgtatgagcggtgtgaagtactg
ttgaggcctcctttcgacacctgccatgcttatgtcagccctctgcccttcgcagccagc
tgtaccagtgacctctgccaatcaggaggcgatgaagccacttggtgccgagcactgatg
gaatatgcccgggcatgtgcacaggcagggcgccctctgcagggctggaggacccaactc
tcacaatgcactgtgcactgcaaagagaaggccttcatctataacgagtgtattgcttgc
tgtccggcttcctgccaatcccgtgcttcatgtgtagacagtgagatcacctgtgtggat
ggctgctactgccccaatgggctgatctttgaggatggaggctgcatgtcaccagctgag
tgtccctgtgaattccatggaaccctgcacccgcctggctctgtggtgacagaagactgc
aatgcctgtacgtgcacagcagggaagtgggtgtgcagctcttccgtctgtccagctgag
tgctcagtgactggtgacattcacttcacgacctttgatggacgccggtacacattccct
gccacgtgtcagtacatcctcgccaagagccgttcctcaggcacatttacagtgacgctg
cagaacgccccgtgtggcctgaaccaggatggggcctgtgtccagtccgtgtcagtgatc
ctgcaccaggaccctcggagacaggtgaccctgacccaggcaggagatgtccttctattt
gaccagtacaagatcaccccaccctactcagatgatgcttttgagatccggaggctgtcc
tccgtgttcctgagggtgaggaccaatgtgggcgtgcggatcctctatgaccgggaaggg
ttgcggctttacctgcaagtggaccagcgatgggtggaggataccgtgggcctctgtggc
accttcaacggcaacacacaggacgacttcctgtctccagtgggtgtacctgagagcaca
ccacagttgtttggcaattcgtggaaaaccctgtctgcctgtgtcccgctggtccctggc
tctttgctggacccctgcgatgtgcatctgcaagctgcctcctatgcactgcagtcctgc
agtgtgctcacgggagagctctttgcaccctgctctgcgtatctgagcccaataccctac
ttcgagcaatgccgcagggatgcctgccgctgtgggcagccctgcctttgtgccacgctg
gcccactacgcacgactatgccggcgccatggactcccggttgacttccgtgcccatctg
ccagcctgtgcactgtcctgtgaggccactaaagagtacagcccttgtgtgaccctgtgc
gcaccaacatgccaggacctggccagccctgacgtctgtggggctaacggaggtggcaac
ttcagcagggaggagtgcgtagagggttgcacctgcccaccggacacatttctggacaca
caggctgacctctgtgtccccaggaaccaatgctcttgccatttccaaggagtggactac
ccccctggggacagtgacatcccttccctgggccactgccactgcaaagatggggtcatg
agctgtgacagccgagccccagctgctgcctgtccagcaggccaggtgttcgtgaactgc
agtgagctgcacccagaccctgagctcagcagggagaggacgtgtgagcagcagctgctg
aacctgagcgtgccagcacgtggcccctgcctgtcgggctgtgcctgtccccagggcctg
ctcagacatggggacgcatgcttcccaccagaggaatgtccatgtacctggaaggggaag
gaatatttccctggggaccaggtagtctcttcctgccacacctgtgtgtgccagcggggc
tcgttccagtgcaccctgcacccctgcgcctccacctgtaccgcctatggggaccgacac
tatcgcacatttgacgggcttccgtatgactttgtaggggcgtgcaaagtgcacctggtc
aagagtacatccgagctcagcttctctgtcatggtggaggatgtgaactgctatggctcc
ggcgtcatctgcaggaagtccatctccatcaacgttggcagctcactcatcatctttgat
gacgactccggggatcccagtcccgagagcttcctggatgagaagcaggctgtccacatc
tggagagcaggctttttcacactggtgcatttcccacgggaacacatcaccctcttgtgg
gaccagagaaccactgtgcatgtccaggcgggccctcagtggcagggtcagttggtgggc
ctctgtgggaactttgacctgaaaaccatcaatgagatgcggaccccagagaacctggag
ttaacaaacccccaggagtttggaagcagttgggctgcggtggagtgcccagatacccct
gatcccagggacacttgtgtcctgaatcctctccgagaaccatttgcaaggaaggagtgt
ggtattctgctcagtgaggtgttcgagacctgccacccagtggttgatgtcacttggttt
tactcaaactgcctgacggacacatgtggctgcagccggggtggcgactgtgagtgcttc
tgtgccagtgtagctgcctatgcccatcagtgttgtcagcacggggtggtcattgactgg
cggacaccccgcatctgcccatatgactgtgacttcttcaacaaagcgctaggtaagggt
ccctaccagctgtccagtgtggcggctggcggtactcttgtggccacgaaggcagtagac
agtgacatagcccttgtgagggcagaggatctggcgccaggggacatttcaagcttcctg
ctgacagctgctctgtacaaggccaaggcccatgaccctgacgtggtgtccctggaggcg
gctgacagacccaacttcttcctgcacaccacagccaatggctctatagggctggctaag
tggcagcgcgatgaggccttccatcagcacgcttccttctcgctgcaccgggggacatgg
caggctggcctggtggctctggagtccctggcaaagcctggctccttcctccactcatca
ggccttgagctggcactgcgggcatacgaacacacggaggtgtttcgtggtggtgcgctc
ttccgccttctggatgccaagcctttgggggctgcctaccccacctgtgagtggcgctac
gatgcctgtgctagcccctgtttccaaacctgccgggacccacgggcaaccagctgccag
gatgtgcccagggtagaaggctgtgtccctgtgtgtcccactcctaaggtcctggatgaa
gtcacacagagatgtgtctacctggaagactgtgtggagccagccccgcggggtcccacg
gagacccttggcaatgagactctggtacctggtcaagtgccacccaccaccagtgccgag
cagcagcttccacaggggctccctggagcctctgcctacagccccgcccctgttccagta
gccccacccacctcagccccaaacccaccaatggctgccacggaggggcaagcgccatct
ccaggatccacccaacccacactgcagacacccctgggccttacaacatctaactttcct
gctggccacacagaggccacagccagagaggaaggggctgccagccttctaaccacttct
catcccccagggttctcgtcctccctccctagttccctgcagatgcccacatctggcatt
gtatcaggtgcaacagagacaaccaaagtgaccataacctttacagggagtcccaacacc
actgtcgcttcccggtcaccccctatacctcgcttcccactcatgaccaaagctgtgaca
gtcccaagtcatgactcctttcctgttaaaaccacacctctgcagccctcttggctatgg
agcctctcttccagacctatgacttcccttggagctacgtcctggccccccacctccccg
ggatcccacctgtcaactgcagtaactaaggtggcaaataagacaatgacatccctgtct
gtcctggcccagagcacttcaagttccagccagcccctggctgcagtgaccacagcacac
agggctcctgccagtccccttgtcaccaagggcttggaggtggtgtcagccacagagaag
ggagaagctgggcacagccagcttacagagttgccagtgtccccacccccaagcccagcc
cccatcgacctgcctcacccagcccaacataccaccacagcccctgggccttctgctctg
tccccggggatcctggctgctggcagtccatccacaggtgctcacagaccgggggccaca
gctttagcttctctagagccaactcggccaccccaccttctctctggcctacctctggac
accagcctgcccttggctaaggtgggaacctctgccccagtggccacacctggctccaaa
ggctatatccccacccctccacctcagcaccaggctacaactttggctacggccatgact
gtgagcccacttactcagtcactcagtctgacagtgccactcatgtctgctgtagaggaa
caggcacactcacctagccccaagcctccccaaggaacaggtatggctccagaccagatg
ctgggagccacattgccaagctttggagcctcctctgtgattgctggggtgccccccaca
gtgtctgcggccccacggaagagcaccacccagagagcagccattctatctaagaaggtg
tctccacccaccctcatctctgactctgtccagggtgggttcacagaactcacacctata
gtgagccatactgttacccccttggcgactgaggctgaaggcccccgggctggcacagtg
ccactggtgcccacaacctactccctaagccgggtgtcagccaggacggcctcccgggaa
ggcccgctagttctgttgcctcagctggcagaggcctatgggaccccagcaggactccag
ccccaagaagatctagtgcgccaggccactacggagcagtcagggcgctcagctccagcc
aagagtatagcagaggagtcgatggaggccgaagtgaatacttctgccacctgtgtgccc
atcgctgaacaagactgtgtccgtcacatatgcctagaaggccagctgatacgtgtgaac
cagacccagcactgtcctcagggtgccgtacgccctcgctgtggggtcctgggcctcgct
gtgcgggtgggcggggatcgctgctgcccacaatgggaatgtgcctgccgatgctcaatc
ttcccagacctgagctttgtaactttcgatggcagccatgcggctctgttcaaggaggcc
atctatgtcctcagccagagcccagatgaaaccatctctgtgcatgtcctggactgcaag
agtgccaacctgggacatctgaactggcccccattctgtctggtgatactgaatgtgact
catctggcccaccatgtcagcatcgaccgcttcaacaggaaggtgactgtggactctcaa
gttgtgtggccacccatgagccgatatggcttccgaattgaggatacaggacacatgtat
atcgtccggacaccctcacacatccagatccagtggcttcacagctcaggactcatgatc
ttggaagccagcaaagtcagcaagacccagggccatggcctgtgtggtatctgtgatgga
gatgcagccaatgacctcaccttgaaggatggctctgtgctgggtgaggcagaggaccct
gctccctttctggacagctggcaggtgcccagctccctgacttcagagggtcagacccgc
ttccgcccagacagttgtgccacagctgactgctcgccctgccttcgcatggtgtccaac
cgaaccttcagtgcctgccacagctttgtctccccagagtcattctgtgagctgtggatc
cgggacaccaagtacgtgcagcagccctgtgtggcactcaccgtgtatgtggctatgtgt
cacaaattccacgtgtgcatcgagtggcggggctccgactattgccccttcctgtgctcc
agtgactctacctaccaggcctgtgtggcagcttgtgaaccccctgacacatgccaggac
gggatactgggccccctggacccagagcagtgccaggtgctgggtgagggctgtgtgtgc
acggagggcaccattctgcaccgacgccactcggcactctgcatccctgaggacaagtgt
gcctgcactgacagcaccggggttccacgtgctctgggggagacctggaacagctccctc
agtggctgctgtcagcagcaatgccaggctccagacaccatcatacccgtggacctggac
tgccctggtccccgacctgagagctgcccccgctttggtgaagtgatcctgttacagccc
acggaggacccctgctgcctggggagtgtctgcgtgtgtaaccagaccctgtgcgagggc
ctcgctcccacctgccgcccaggccacagcctcatcacccacttccaggaggattcctgc
tgtcccagctacagctgcgagtgtgaccctggtctgtgtgaggctgagcaggtccccacc
tgtcgtgaggaccagatcttgatcgagggccgcctaggagactcctgctgcacctcctac
ttctgtggctgtggtgagtgttcagatcccatgcctgagtgtcaggaaggagaggcactc
actgtgcacaggaacaccacagagctctgctgccctctgtatcagtgtgtgtgtgagaac
ttccgctgcccacaggtacagtgtggcatgggcacttccctggtggaggtgtggagccca
gaccgatgctgcccctacaagtcctgcgagtgtgactgtgacactattcctgtgcccaga
tgccatctgtgggaaaagtcgcagctggatgaggagtttatgcacagcgtggagaatgtg
tgcggctgcgccaagtacgagtgcgtgaaagcccctgtatgcctgagccgtgagctgggt
gtgatgcagccaggccagactgtggtagagctctcagcggatggtgtgtgtcatacgtcc
cgatgcacagacgtgctggaccctctcaccaacttctaccagatcaacatcacctctgtc
ctctgtgacatgcactgcgaggcgaaccaggagtatgaccacccacgggacctggcggcc
tgctgcggctcctgcagaaacgtgtcctgcctcttcaccttccccaatggcaccacttcc
ctgttcttgcctggtgcatcctggatcgcggactgtgcccgccatcactgtggcagcacc
cccctgggtgctgtgcttgtccgctcgcccatcagctgccctccattcaatgaaaccgag
tgtgccaaggttggtggctctgtggtaccatccttggaaggatgctgcagagcatgtaag
gaggatggacggtcttgcaagaaggtgaccattcgcatgaccatccgcaagaatgactgc
aggagcaatacccctgtgaacctggtgtcttgcgatgggaggtgcccttctgccagcatc
tacaaccacaacatcaacacctatgcccgcttctgcaagtgctgccgtgaggtgggactg
cagcgtcgctctgtgcagctcttctgtgccacgaatgctacctgggtgccctatacagta
caggagcctacagactgtgcctgccagtggtcctga

DBGET integrated database retrieval system