KEGG   Mus musculus (house mouse): 18424
Entry
18424             CDS       T01002                                 
Symbol
Otx2, E130306E05Rik
Name
(RefSeq) orthodenticle homeobox 2
  KO
K18490  homeobox protein OTX2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18424 (Otx2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain Paired-related
    18424 (Otx2)
SSDB
Motif
Pfam: TF_Otx Homeodomain NUDE_C SatD
Other DBs
NCBI-GeneID: 18424
NCBI-ProteinID: NP_001273410
MGI: 97451
Ensembl: ENSMUSG00000021848
UniProt: Q8R0B5 Q8VD35
Position
14:complement(48894238..48905101)
AA seq 297 aa
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDV
LEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAK
KKSSPAREVSSESGTSGQFSPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQ
RSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLN
QSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL
NT seq 894 nt   +upstreamnt  +downstreamnt
atgatgtcttatctaaagcaaccgccttacgcagtcaatgggctgagtctgaccacttcg
ggtatggacttgctgcatccctccgtgggctaccccgggccctgggcttcttgtcctgca
gccaccccccggaaacagcgaagggagaggacgacatttactagggcacagctcgacgtt
ctggaagctctgtttgccaagacccggtacccagacatcttcatgagggaagaggtggca
ctgaaaatcaacttgccagaatccagggtgcaggtatggtttaagaatcgaagagctaag
tgccgccaacagcagcagcagcagcagaatggaggtcagaacaaagtgaggcctgccaag
aagaagagctctccagctcgggaagtgagttcagagagtggaacaagtggccagttcagt
cccccctctagtacctcagtcccaaccattgccagcagcagtgctccagtgtctatctgg
agcccagcgtccatctccccactgtctgaccccttgtccacttcctcctcctgcatgcag
aggtcctatcccatgacctatactcaggcttcaggttatagtcaaggctatgctggctca
acttcctactttgggggcatggactgtggatcttatttgacccctatgcatcaccagctt
cctggaccaggggccacactcagtcccatgggtaccaatgctgttaccagccatctcaat
cagtccccagcttctctttccacccagggatatggagcttcaagcttgggttttaactca
accactgattgcttggattataaggaccaaactgcctcttggaagcttaacttcaatgct
gactgcttggattataaagatcagacgtcctcatggaaattccaggttttgtga

DBGET integrated database retrieval system