KEGG   Mus musculus (mouse): 18429
Entry
18429             CDS       T01002                                 

Gene name
Oxt, OT, Ox, Oxy
Definition
(RefSeq) oxytocin
  KO
K05243  oxytocin-neurophysin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    18429 (Oxt)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    18429 (Oxt)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    18429 (Oxt)
SSDB
Motif
Pfam: Hormone_5 Hormone_4
Other DBs
NCBI-GeneID: 18429
NCBI-ProteinID: NP_035155
MGI: 97453
Ensembl: ENSMUSG00000027301
Vega: OTTMUSG00000015519
UniProt: P35454 Q545V4
Position
2 F1; 2 63.24 cM
AA seq 125 aa
MACPSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDMRKCLPCGPGGKGRCFGPSICCA
DELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAATGICCSPDGCRTDPACDPES
AFSER
NT seq 378 nt   +upstreamnt  +downstreamnt
atggcctgccccagtctcgcttgctgcctgcttggcttactggctctgacctcggcctgc
tacatccagaactgccccctgggcggcaagagggctgtgctggacctggatatgcgcaag
tgtctcccctgcggcccgggcggcaaaggacgctgcttcggaccaagcatctgctgcgcg
gacgagctgggctgcttcgtgggcaccgccgaggcgctgcgctgccaggaggagaactac
ctgccttcgccctgccagtctggccagaagccctgcgggagcggaggccgctgcgccgcc
acaggcatctgctgcagcccggatggctgccgcacagaccccgcctgcgaccctgagtct
gccttctcggagcgctga

DBGET integrated database retrieval system