KEGG   Mus musculus (mouse): 18430
Entry
18430             CDS       T01002                                 

Symbol
Oxtr, O, OTR
Name
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    18430 (Oxtr)
   04024 cAMP signaling pathway
    18430 (Oxtr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    18430 (Oxtr)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    18430 (Oxtr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    18430 (Oxtr)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Oxytocin
    18430 (Oxtr)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 18430
NCBI-ProteinID: NP_001074616
MGI: 109147
Ensembl: ENSMUSG00000049112
Vega: OTTMUSG00000056498
UniProt: P97926
Position
6; 6 E3
AA seq 388 aa
MEGTPAANWSIELDLGSGVPPGAEGNLTAGPPRRNEALARVEVAVLCLILFLALSGNACV
LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASVPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AAEGSDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWD
VNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSARYLKGSRPGETS
ISKKSNSSTFVLSRRSSSQRSCSQPSSA
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggagggcacgcccgcagccaactggagtatcgagttggacctcgggagtggagtgcca
ccaggggcggagggtaacctcacggccgggccgccacgacgcaacgaggccctggcgcgc
gtggaggtggcggtcctgtgtctcatactgttcctggctctgagtggcaacgcgtgcgtg
ctgctggcgctgcgtacgacgcgccacaagcactcgcgcctcttctttttcatgaagcac
ctgagcatcgccgacctggtggtggccgtgttccaggttctcccgcagctgctgtgggac
atcaccttccgcttctacgggcccgacctgctgtgtcgtctggtcaaatacttgcaggtg
gtgggcatgttcgcctccacctacctgctgttgctgatgtcgctcgaccgctgcctggcc
atctgccagccgctgcgctcactgcgccgccgaaccgaccgcctggcggtgctggcgacg
tggctcggctgcctggtggccagcgtgccgcaggtgcacattttctcgctgcgcgaagtg
gcggacggcgtcttcgattgctgggcggtcttcatccagccctggggacccaaggcctac
gtcacgtggatcacgctcgccgtctacattgtaccggtcatcgtgctggccgcctgctat
ggtctcatcagcttcaagatctggcagaatctgcgactcaagacggcagccgcggcggca
gctgccgaggggagtgacgcagccggtggagctggccgtgcggcgttggcacgggtcagt
agtgtcaagcttatctccaaggccaaaatccgcacagtgaagatgaccttcatcattgtt
ctggccttcatcgtgtgctggacgcctttcttcttcgtgcagatgtggagcgtctgggac
gtcaatgcgcccaaagaagcttctgccttcatcattgccatgctcttggccagcctcaac
agctgctgcaacccatggatctacatgctcttcacgggccatctcttccacgaactcgtg
cagcgcttcctctgctgctctgctcggtacctgaagggcagccggcctggagagacgagc
attagcaagaaaagcaactcctccaccttcgtcctgagtcgtcgcagctcgagtcagagg
agctgttctcaaccatcctcggcatga

DBGET integrated database retrieval system