KEGG   Mus musculus (mouse): 18431
Entry
18431             CDS       T01002                                 

Gene name
Oca2, D7H15S12, D7Icr28RN, D7Nic1, p, p<cas>
Definition
(RefSeq) oculocutaneous albinism II
  KO
K24200  P protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    18431 (Oca2)
Transporters [BR:mmu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   18431 (Oca2)
SSDB
Motif
Pfam: CitMHS Na_sulph_symp ArsB
Other DBs
NCBI-GeneID: 18431
NCBI-ProteinID: NP_068679
MGI: 97454
Ensembl: ENSMUSG00000030450
Vega: OTTMUSG00000025863
UniProt: Q62052
Position
7 B5; 7 33.44 cM
AA seq 833 aa
MRLENKDIRLASAVLEVELHQTSALSVPTCPDPGRLLTVKPATSNYKLGQADPCIPYAGE
AAGKSVCVPEHTEFGSFLVKGSSSLKDLSFKEDTPLLWNSSQKKRSQLMPVHHPEFIATE
GSWENGLTAWEQKCMLGKEVADLSALASSEKRDLAGSVHLRAQVSKLGCCVRWIKITGLF
VFVVLCSILFSLYPDQGKFWQLLAVSPLENYSVNLSGHADSMILQLDLAGALMAGGPSGS
GKEEHVVVVVTQTDAAGNRRRRPQQLTYNWTVLLNPRSEHVVVSRTFEIVSREAVSISIQ
ASLQQTRLVPLLLAHQFLGASVEAQVASAVAILAGVYTLIIFEIVHRTLAAMLGALAALA
ALAVVGDRPSLTHVVEWIDFETLALLFGMMILVAVFSETGFFDYCAVKAYQLSRGRVWAM
IFMLCLMAAILSAFLDNVTTMLLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGGAATAIG
DPPNVIIVSNQELRKMGLDFAGFTAHMFLGICLVLLVSFPLLRLLYWNKKLYNKEPSEIV
ELKHEIHVWRLTAQRISPASREETAVRGLLLEKVLALEHLLAQRLHTFHRQISQEDKNWE
TNIQELQRKHRISDRSLLVKCLTVLGFVISMFFLNSFVPGIHLDLGWIAILGAIWLLILA
DIHDFEIILHRVEWATLLFFAALFVLMEALTHLHLVEYVGEQTALLIKMVPEDQRFAAAI
VLIVWVSALASSLIDNIPFTATMIPVLLNLSQDPEISLPALPLMYALALGACLGGNGTLI
GASTNVVCAGIAEKHGYGFSFMEFFRLGFPVMLMSCTIGMCYLLIAHIVVGWN
NT seq 2502 nt   +upstreamnt  +downstreamnt
atgcgcctagagaacaaagacatcaggctggcctcagccgtgctggaagtagagctacac
cagacatctgctttgtcggtcccaacttgcccagacccaggacggctgctgaccgtcaaa
cctgctaccagtaactacaagctgggccaggcagacccctgcatcccatatgctggcgag
gctgctgggaagagcgtctgtgttcctgaacatacagagtttggctcattcctcgtgaag
gggagctccagcttaaaagacctttcttttaaggaagacactcctctgctctggaattca
tcccaaaagaaaaggtcacagctcatgcctgttcatcacccagaattcatagctactgaa
ggttcctgggaaaatggccttactgcctgggagcaaaaatgcatgctgggtaaagaggtt
gctgatttgtctgcattggcctcctcagagaaacgggatcttgcaggcagtgtccatctt
agagcccaggtctccaagcttgggtgctgtgtgcggtggataaagatcacaggcttgttt
gttttcgtggtgctctgctctattttattcagcctgtatccggaccaaggaaagttctgg
cagctgttggctgtgtcaccgctggaaaactactctgtgaacctcagtggtcacgcggac
tccatgatacttcagctggacctggcaggggccttaatggctggaggaccaagtggttcc
gggaaagaagaacatgtcgtggtggtggtgacccagacagacgcagcgggcaacagacgg
cggcgaccacagcagctcacctacaattggactgtccttttaaatccaagaagtgagcac
gtggtggtgagcagaacctttgagatagtgagcagggaggctgtttccatcagcatccag
gcctctctccaacagactcgcctcgttcctcttttgctggcccatcagttccttggggca
agcgttgaagcacaagtggccagtgcggtggcaatccttgcaggggtttatactctgatc
atatttgagattgttcacagaaccctggcagccatgttgggagcacttgcagcactagca
gccttggctgtggttggagatagacccagcctgacccacgtggtggagtggattgatttc
gagactctggccctgctgtttggcatgatgatcttagtagccgtattttcagaaacagga
ttttttgattactgtgctgtaaaggcatatcaactttctcgaggaagagtgtgggccatg
atcttcatgctttgtctcatggctgccatcctttctgccttcttagacaatgtcactacg
atgctcctttttacccctgtcaccataaggttatgtgaagtgctcaatcttgatccgaga
caagtcctcattgcagaagtgatcttcacaaacattggaggagctgccactgctattggg
gacccaccaaatgttatcattgtttccaatcaggagttgagaaaaatgggcctggacttc
gctggtttcacagcacacatgttcctgggaatttgccttgttctcctggtctcctttccc
ctcctcagacttctgtactggaacaaaaagctttataacaaggagcctagtgagatcgtc
gaactgaagcatgagattcatgtctggcgtttgactgcccagcgcatcagtccagccagc
cgtgaggagacagctgtgcgtggcttgctgctggagaaagtgcttgccctggagcatctg
ctggctcaaaggttgcacactttccacaggcaaatttcacaggaagacaaaaattgggag
accaatattcaagagctacaaagaaagcacaggatttcagacaggagtctgcttgtcaag
tgcctgacggtgctgggatttgtcatctccatgttctttctcaactcctttgtccctggc
attcatcttgatcttggatggattgctattctgggtgccatctggttgctaattttagct
gatattcatgactttgagatcattctacacagagtagagtgggcgactcttctcttcttt
gcagcactctttgtgctgatggaggcattgacacatcttcacttagtagagtatgttgga
gaacagactgccctactaataaagatggttccagaagatcagcgctttgcagctgccatt
gtcctgatagtgtgggtctcagccttggcatcatccttgattgacaacatcccatttact
gctacgatgattcctgtactcctgaacctgagccaagaccctgaaattagtttgcctgca
ctgcctctcatgtatgccctggccctcggtgcctgcctgggaggtaatgggacacttatc
ggagcatccacaaatgttgtttgtgcaggaatcgcagagaagcatgggtatggattctct
ttcatggaatttttcaggttgggcttccctgtgatgctcatgtcctgcaccattgggatg
tgctatctcctgattgctcacattgtggtgggatggaattaa

DBGET integrated database retrieval system