KEGG   Mus musculus (mouse): 18438
Entry
18438             CDS       T01002                                 

Gene name
P2rx4, AI504491, AW555605, D5Ertd444e, P2X4
Definition
(RefSeq) purinergic receptor P2X, ligand-gated ion channel 4
  KO
K05218  P2X purinoceptor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    18438 (P2rx4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    18438 (P2rx4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    18438 (P2rx4)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   18438 (P2rx4)
SSDB
Motif
Pfam: P2X_receptor DUF3624
Other DBs
NCBI-GeneID: 18438
NCBI-ProteinID: NP_001297647
MGI: 1338859
Ensembl: ENSMUSG00000029470
Vega: OTTMUSG00000021392
UniProt: D3Z5U5
Position
5 F; 5 62.53 cM
AA seq 366 aa
MAGCCSVLRAFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSV
VSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIP
DKTSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGVPTPAFLK
AAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTDPFCPIFRLGQIVADAG
HSFQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYY
RDLAGNEQRTLTKAYGIRFDIIVFGKATVLCDVIVLYCMKKRYYYRDKKYKYVEDYEQGL
SGETDQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggcaggctgctgctccgtgctccgggctttcctgttcgagtacgacacgccgcgcatc
gtgctcatccgcagccgtaaagtggggctcatgaaccgcgtggtgcagctgctcatcctg
gcttacgtcattgggtgggtgttcgtgtgggaaaagggctaccaggaaacggactctgtg
gtcagctcggtgacaaccaaagccaaaggtgtggctgtgaccaacacttctcagcttgga
ttccggatctgggacgtggccgactatgtggtcccagctcaggaggaaaactccctcttc
atcatgaccaacatgatcgtcaccgtgaaccagacgcagggtacctgtccagagattcct
gataagaccagcatttgcgattcagacgccaactgcactctcggctcctcggacacccac
agcagtggaattgggactggaaggtgtgttccattcaacgcgtctgtgaagacctgtgag
gtggccgcatggtgcccagtggagaatgacgctggtgtgccaacgccagcttttttaaag
gctgcagaaaacttcaccctcttggtaaagaacaacatctggtaccccaagtttaatttc
agcaagaggaatatcctccccaacattaccacctcctacctcaagtcgtgcatttataat
gcgcggacggatcccttctgccccatattccgtcttggccaaatcgtggcggatgcgggc
cacagctttcaggagatggcagtggagggaggcatcatgggtatccagatcaagtgggac
tgcaaccttgacagagctgcctcccactgcctgcccagatattccttccggcgcctcgac
actcgggacttagaacacaacgtgtctcctggctacaatttcaggtttgccaagtactac
agggaccttgctggcaatgagcaacgcacactcaccaaggcatatggcatccgctttgac
atcatcgtgtttggaaaggcgaccgtgctgtgtgacgtcatagtcctctactgtatgaag
aagagatactactaccgggacaagaaatataagtatgtggaagactacgagcagggtctt
tccggagagacggaccagtga

DBGET integrated database retrieval system