KEGG   Mus musculus (mouse): 18439Help
Entry
18439             CDS       T01002                                 

Gene name
P2rx7, AI467586, P2X(7), P2X7R
Definition
(RefSeq) purinergic receptor P2X, ligand-gated ion channel, 7
  KO
K05220  P2X purinoceptor 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    18439 (P2rx7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    18439 (P2rx7)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    18439 (P2rx7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    18439 (P2rx7)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   18439 (P2rx7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor Keratin_matx
Motif
Other DBs
NCBI-GeneID: 18439
NCBI-ProteinID: NP_035157
MGI: 1339957
Ensembl: ENSMUSG00000029468
Vega: OTTMUSG00000026740
UniProt: Q9Z1M0 C8YIX4 Q8CHP4
Position
5; 5 F
AA seq 595 aa AA seqDB search
MPACCSWNDVLQYETNKVTRIQSTNYGTVKWVLHMIVFSYISFALVSDKLYQRKEPVISS
VHTKVKGIAEVTENVTEGGVTKLGHSIFDTADYTFPLQGNSFFVMTNYVKSEGQVQTLCP
EYPRRGAQCSSDRRCKKGWMDPQSKGIQTGRCVPYDKTRKTCEVSAWCPTEEEKEAPRPA
LLRSAENFTVLIKNNIHFPGHNYTTRNILPTMNGSCTFHKTWDPQCSIFRLGDIFQEAGE
NFTEVAVQGGIMGIEIYWDCNLDSWSHHCRPRYSFRRLDDKNTDESFVPGYNFRYAKYYK
ENNVEKRTLIKAFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLATVCIDLLINTYSS
AFCRSGVYPYCKCCEPCTVNEYYYRKKCESIMEPKPTLKYVSFVDEPHIRMVDQQLLGKS
LQVVKGQEVPRPQMDFSDLSRLSLSLHDSPLTPGQSEEIQLLHEEVAPKSGDSPSWCQCG
NCLPSRLPEQRRALEELCCRRKPGRCITTSKLFHKLVLSRDTLQLLLLYQDPLLVLGEEA
TNSRLRHRAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKTEGQYSGFKYPY
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgccggcttgctgcagctggaacgatgtcttgcagtatgagacaaacaaagtcacccgg
atccagagcacgaattatggcaccgtcaagtgggtcttgcacatgatcgtcttttcctac
attagctttgctttggtgagcgataagctgtaccagcggaaagagcctgttatcagctcc
gtgcacaccaaggtcaaaggcatagcagaggtgacggagaatgtcacagagggtggggtg
acgaagttaggacacagcatctttgacactgcagactacaccttccctttgcaggggaac
tcattctttgtcatgacaaactatgtcaagtcagaaggccaagtgcagacgctgtgtcct
gagtatcccaggcgcggtgcacagtgctcttctgaccggcgttgtaaaaaggggtggatg
gacccacagagcaaaggaatccagactggcaggtgtgttccatatgacaagacaaggaag
acctgtgaagtctctgcctggtgtcctactgaggaggagaaagaagctccccgacctgca
ctcttgaggagcgccgaaaacttcaccgtactcatcaagaataatatccacttccccggc
cacaactataccacgagaaacatcttgccaactatgaacggctcttgtacctttcacaag
acttgggaccctcagtgttccatcttccgactaggggacatcttccaggaagcaggagag
aactttacagaggtggcagttcagggaggaatcatgggtatcgagatctactgggattgc
aacctagacagctggtcccatcactgccgacccaggtacagcttccgccgcctggatgac
aagaacacggatgagtccttcgtccccggctacaacttcagatatgccaagtactataag
gagaacaatgtggaaaagcggacgttgatcaaagccttcggcatccgttttgacatcctg
gttttcggcactggaggaaaatttgacatcatccagctggttgtatacattggatccacc
ctgtcctactttggcttggccactgtgtgcattgacttgctcatcaacacatactccagt
gctttctgcaggtcgggggtttacccctactgtaagtgctgtgagccctgcacagtgaac
gagtattactacagaaagaagtgtgagtccatcatggaacccaagccgacgttgaagtat
gtgtcctttgtcgacgagccgcacattcgcatggtggaccagcagctgcttgggaaaagt
ctgcaagttgtcaaaggccaagaagttccaagaccccagatggacttctccgacctgtct
aggctgtccctatctctccacgactcacccctgactcctggacaatctgaggaaattcag
ctgctccatgaagaggtggcccctaagtccggggacagcccgagttggtgccagtgtgga
aattgcctcccgtctcgcctaccggagcaacgcagggccctggaggagctgtgctgccgg
aggaagccggggcggtgcatcaccacctccaagctcttccataagctcgtgctgtcccga
gacaccctgcagctcctcctgctttaccaggatcccttgctggtgctgggggaagaggcc
accaacagcaggctgcgacaccgtgcttacaggtgctatgccacctggcgcttcggctcc
caggacatggccgactttgccattctgcccagctgttgccgctggaggatccggaaggag
ttccccaagaccgaggggcagtatagtggcttcaagtatccctactga

DBGET integrated database retrieval system