KEGG   Mus musculus (mouse): 18441
Entry
18441             CDS       T01002                                 

Gene name
P2ry1, P2Y, P2Y1, P2y1r
Definition
(RefSeq) purinergic receptor P2Y, G-protein coupled 1
  KO
K04270  P2Y purinoceptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04611  Platelet activation
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    18441 (P2ry1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    18441 (P2ry1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    18441 (P2ry1)
  09157 Sensory system
   04742 Taste transduction
    18441 (P2ry1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    18441 (P2ry1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    18441 (P2ry1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 18441
NCBI-ProteinID: NP_001268945
MGI: 105049
Ensembl: ENSMUSG00000027765
Vega: OTTMUSG00000051935
UniProt: P49650 Q544J5 Q8BMJ5
Position
3; 3 E1
AA seq 373 aa
MTEVPWSVVPNGTDAAFLAGLGSLWGNSTVASTAAVSSSFQCALTKTGFQFYYLPAVYIL
VFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
DAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAIYVSVLVWLIVV
VAISPILFYSGTGTRKNKTVTCYDTTSNDYLRSYFIYSMCTTVAMFCIPLVLILGCYGLI
VKALIYNDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPEMCDFND
RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEEMTLN
ILSEFKQNGDTSL
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaccgaggtgccttggtcggttgtccccaacgggacggatgctgcctttctggcgggc
ctgggctcgctttggggaaacagtactgtcgcctcaactgcagcagtttcctcttcattc
caatgtgccctgaccaagaccggtttccagttctactacctgccggctgtctacatttta
gtgttcatcataggcttcctaggcaacagcgtggctatctggatgttcgttttccacatg
aagccttggagcggcatctccgtgtacatgttcaatttggctctggctgactttttatac
gtgctcaccctaccagccctcatcttctactacttcaacaagactgactggatcttcggg
gatgctatgtgcaagctgcagagattcatcttccacgtaaatctctacggtagcatcttg
ttcctcacctgcatcagcgcacacaggtacagtggcgtggtgtaccctctcaagtctctg
ggcaggctcaagaagaagaatgccatttatgtcagcgtgctggtgtggctcattgtggtg
gtggccatctcccctattctcttctactctggcactgggactcggaaaaacaaaactgtc
acctgctatgacaccacgtccaatgattacctgcgaagttatttcatctacagtatgtgc
acgactgtggccatgttctgcatccctttggtgctgatcttgggctgttatggattaatt
gttaaagctttgatttacaatgacctggacaactctccgctccggaggaaatccatttac
ctggtgataattgtcctgacggtgtttgctgtgtcttatatccctttccatgtgatgaaa
acgatgaatttgcgagcacggttggatttccagaccccagaaatgtgtgatttcaacgac
agggtttatgccacttatcaggtaacaagaggtctagcaagtctcaacagctgtgtggac
cccattctttatttcttggctggagatacattcagaaggagactgtcccgagccaccagg
aaagcttccaggaggagtgaggccaatttacaatccaagagtgaagaaatgactctcaat
attttatctgagttcaagcagaatggagacacgagtttgtga

DBGET integrated database retrieval system