KEGG   Mus musculus (mouse): 18451
Entry
18451             CDS       T01002                                 

Gene name
P4ha1, AL022634, P4, P4ha
Definition
(RefSeq) procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), alpha 1 polypeptide
  KO
K00472  prolyl 4-hydroxylase [EC:1.14.11.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00330  Arginine and proline metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    18451 (P4ha1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.2  procollagen-proline 4-dioxygenase
     18451 (P4ha1)
SSDB
Motif
Pfam: P4Ha_N 2OG-FeII_Oxy_3 2OG-FeII_Oxy TPR_2 TPR_14 TPR_1 Fis1_TPR_C
Other DBs
NCBI-GeneID: 18451
NCBI-ProteinID: NP_001303300
MGI: 97463
Ensembl: ENSMUSG00000019916
Vega: OTTMUSG00000034134
UniProt: Q60715 Q3UF16
Position
10; 10 B4
AA seq 534 aa
MIWVVLMMAILLPQSLAHPGFFTSIGQMTDLIHNEKDLVTSLKDYIKAEEDKLEQIKKWA
EKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLILKDMSDGFISNLTIQRQY
FPNDEDQVGAAKALFRLQDTYNLDTNTISKGNLPGVQHKSFLTAEDCFELGKVAYTEADY
YHTELWMEQALTQLEEGELSTVDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQR
ANGNLVYFEYIMSKEKDANKSASGDQSDQKTAPKKKGIAVDYLPERQKYEMLCRGEGIKM
TPRRQKRLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRL
SRATVHDPETGKLTTAQYRVSKSAWLSGYEDPVVSRINMRIQDLTGLDVSTAEELQVANY
GVGGQYEPHFDFARKDEPDAFRELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKG
TAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPCTLSELE
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgatctgggttgttttaatgatggcgattctacttcctcagtctttagcccatccaggg
ttttttacgtcaattggtcagatgactgacttgatccataatgagaaagacctggtgaca
tcactaaaagattatattaaagcagaagaggacaagttagagcaaatcaaaaaatgggca
gagaagttagaccggctaacgagtacagcaacaaaagacccagaggggtttgttgggcat
cctgtaaacgcattcaagttaatgaaacgtctgaacactgagtggagtgagttggagaat
ctgatcctcaaggacatgtcggatggcttcatctctaacctaaccattcagaggcagtac
ttccctaatgatgaagatcaggttggagctgctaaagctctgtttcggctgcaagacacc
tacaatctggacacaaataccatctcaaaggggaatcttccaggagtgcaacataagtct
ttcctgacagccgaggactgctttgagctgggcaaagtggcctatacagaggcagattat
taccacacagaactgtggatggagcaggctctgacgcagctggaggagggagagctgtct
actgtagataaagtctctgttctggattacctgagctatgcggtgtaccagcagggagac
ctggataaggcgcttctcctcaccaagaagcttcttgagctagatcctgaacatcagaga
gctaatggtaacttagtatattttgaatatataatgagtaaagaaaaagatgccaataag
tcagcgtcgggcgaccaatctgatcagaaaactgcaccaaagaaaaaagggatagctgtg
gattacctgccagagagacagaagtacgaaatgctgtgccgtggggagggtatcaaaatg
actccccggagacagaaaagactgttctgccgctaccatgatgggaaccggaatcctaag
ttcatcctggccccagccaagcaggaggacgagtgggacaagccccggattatccgtttc
catgacatcatctctgacgcggagattgagattgtcaaagacttagcaaaaccaaggctg
agccgagctacagtacatgaccctgagacggggaaattgaccacagcacagtacagagta
tctaagagtgcttggctgtctggctacgaagaccctgtggtatcccgaattaatatgaga
atacaagatctcacaggactggatgtttctacggccgaggagttacaggtagcaaattac
ggagttggaggacagtatgagccccattttgactttgcaaggaaagatgagccggatgcc
tttagagagcttgggacaggaaataggattgccacgtggctgttctatatgagcgatgtg
tctgctggaggagctactgtttttcctgaagtgggagccagtgtttggcccaaaaaaggc
actgctgtcttctggtataatctgtttgccagtggggaaggagattacagtacacggcat
gcagcctgtcccgtgctagttggaaacaaatgggtatccaacaaatggctccatgaacgt
ggacaagaatttcgaaggccgtgcaccctgtcagaattggaatga

DBGET integrated database retrieval system