KEGG   Mus musculus (mouse): 18457
Entry
18457             CDS       T01002                                 

Gene name
Bloc1s6, BLOC, BLOC-1, Hps9, P, Pldn, Stx13bp1, pa
Definition
(RefSeq) biogenesis of lysosomal organelles complex-1, subunit 6, pallidin
  KO
K20188  biogenesis of lysosome-related organelles complex 1 subunit 6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18457 (Bloc1s6)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Others
   BLOC-1 complex
    18457 (Bloc1s6)
Motif
Pfam: Snapin_Pallidin TCP
Other DBs
NCBI-GeneID: 18457
NCBI-ProteinID: NP_062762
MGI: 1927580
Ensembl: ENSMUSG00000005804
Vega: OTTMUSG00000015683
UniProt: Q9R0C0
Position
2 E5; 2 60.66 cM
AA seq 172 aa
MSVPEPPPPDGVLTGPSDSLEAGEPTPGLSDTSPDEGLIEDFPVDDRAVEHLVGGLLSHY
LPDLQRSKRALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFTEAKHYHAKLVTIRK
EMLLLHEKTSKLKKRALKLQQKRQREELEREQQREKEFEREKQLTAKPAKRT
NT seq 519 nt   +upstreamnt  +downstreamnt
atgagtgttcctgagccaccgcctccagacggggtccttacggggccttccgacagcctg
gaggccggcgagcccacgccgggcttaagcgacacgtctccagatgaaggactgatagag
gacttccctgtggacgatagagctgtagagcacttggtgggaggcctgctgtcccactac
ttaccagatctgcagaggtccaagcgagcactccaggaactcacacagaaccaagttgtg
ttactagatacactggaacaagagatttcaaaatttaaagaatgccactccatgttggac
atcaatgctttgttcacagaggcgaagcactatcacgccaagctggtgactataaggaag
gagatgctgctgctccatgagaaaacgtccaagttgaaaaaaagagcactgaagctgcag
cagaagcggcagagagaagagctggagagggagcagcaacgcgaaaaggaatttgaaaga
gaaaagcagctgacagccaagccagccaagaggacatga

DBGET integrated database retrieval system