KEGG   Mus musculus (house mouse): 18458
Entry
18458             CDS       T01002                                 
Symbol
Pabpc1, PABP, Pabp1, PabpI, Pabpl1, ePAB
Name
(RefSeq) poly(A) binding protein, cytoplasmic 1
  KO
K13126  polyadenylate-binding protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    18458 (Pabpc1)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    18458 (Pabpc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    18458 (Pabpc1)
   03041 Spliceosome [BR:mmu03041]
    18458 (Pabpc1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     18458 (Pabpc1)
   mRNA cycle factors
    Stress granule specific factors
     18458 (Pabpc1)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   Complex C specific factors
    18458 (Pabpc1)
SSDB
Motif
Pfam: RRM_1 PABP RRM_7 RRM_5 RRM_occluded RRM_3 ATP-grasp_2 YflT
Other DBs
NCBI-GeneID: 18458
NCBI-ProteinID: NP_032800
MGI: 1349722
Ensembl: ENSMUSG00000022283
UniProt: P29341
Position
15:complement(36595902..36609825)
AA seq 636 aa
MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN
LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVAT
KPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA
AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
RVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQ
GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESP
ESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgaaccccagcgcccccagctaccccatggcctctctgtacgtgggggacctgcacccc
gacgtgaccgaggcgatgctctacgagaagttcagcccggccgggcccatcctctccatc
cgggtctgcagggacatgatcacccgccgctccttgggctacgcgtacgtgaacttccag
cagccggcggacgcggaacgtgctttggacaccatgaattttgatgttataaagggcaag
ccagtacgcatcatgtggtctcagcgtgatccatcacttcgcaaaagtggagtaggcaac
atattcattaaaaatttggacaaatccatcgacaataaagcactatatgatacgttttct
gcgtttggtaacatcctttcatgtaaggtggtttgtgatgaaaatggctccaagggctat
ggatttgtacactttgaaacacaggaagcagctgaaagagctattgaaaaaatgaatggg
atgcttctaaatgatcgtaaagtgtttgttggacgatttaaatctcggaaggaacgagaa
gcagagcttggagccagggcaaaggagttcaccaatgtttacatcaagaactttggagaa
gacatggatgatgagcgccttaaggaactctttggcaagtttgggcctgccttaagtgtg
aaagtaatgacagatgaaagtggaaaatccaaaggatttggatttgtaagctttgaaagg
catgaagatgcgcagaaagctgtggatgagatgaatgggaaggagctcaatggaaaacag
atttatgttggacgagctcagaaaaaagtggaacggcagacggaacttaagcgcaaattt
gagcagatgaagcaagataggatcaccagatatcagggtgtgaacctttatgtgaaaaat
cttgatgacgggattgatgatgagcgtctccggaaggagttttctccgtttggtacaatc
accagtgcaaaagtaatgatggagggtgggcgcagcaaagggtttggttttgtatgtttc
tcatcccctgaagaagccactaaagcagttacagagatgaatggtagaattgtggccacg
aagccactgtatgtagctttagctcagcgcaaagaagagcgccaggctcacctcactaac
cagtatatgcagaggatggcaagtgtacgagctgtgcccaaccccgtgatcaacccctac
cagccagcacctccttcaggttacttcatggcagctatcccacagactcagaaccgtgct
gcatactatcctcctagccaaattgctcaactaagaccaagtcctcgctggactgctcag
ggtgccagacctcatccattccagaatatgcccggtgctatccgcccagctgctcctaga
ccaccatttagtacgatgagaccagcttcctcacaggttccacgagtcatgtcaacacag
cgtgttgctaacacatcaacacagacaatgggtccacgtcctgcagctgctgctgctgca
gccactcctgctgtccgcaccgttccccagtataaatatgctgcgggagtccgcaatccc
cagcaacatcttaatgcacagccacaagttaccatgcaacagcctgctgttcatgtgcaa
ggtcaagaacctttaactgcttccatgttggcatctgcgcccccgcaagagcagaagcaa
atgttgggtgaacggctgtttcctcttatccaagccatgcacccttctcttgctggtaaa
atcactggcatgctgttggagattgataactcagaattacttcacatgctcgagtctcca
gagtctctccgctcaaaggttgatgaagctgtagctgtactacaagcccaccaagcgaaa
gaggctgcccagaaagcagtgaacagtgccactggtgttccaactgtctaa

DBGET integrated database retrieval system