KEGG   Mus musculus (mouse): 18458
Entry
18458             CDS       T01002                                 

Gene name
Pabpc1, PABP, Pa, Pabp1, PabpI, Pabpl1, ePAB
Definition
(RefSeq) poly(A) binding protein, cytoplasmic 1
  KO
K13126  polyadenylate-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu03015  mRNA surveillance pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    18458 (Pabpc1)
   03015 mRNA surveillance pathway
    18458 (Pabpc1)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    18458 (Pabpc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    18458 (Pabpc1)
   03041 Spliceosome [BR:mmu03041]
    18458 (Pabpc1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     18458 (Pabpc1)
   mRNA cycle factors
    Stress granule specific factors
     18458 (Pabpc1)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   Complex C specific factors
    18458 (Pabpc1)
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_occluded RRM_3 ATP-grasp_2
Other DBs
NCBI-GeneID: 18458
NCBI-ProteinID: NP_032800
MGI: 1349722
Ensembl: ENSMUSG00000022283
Vega: OTTMUSG00000019779
UniProt: P29341
Position
15; 15 B3.1
AA seq 636 aa
MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN
LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVAT
KPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA
AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
RVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQ
GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESP
ESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgaaccccagcgcccccagctaccccatggcctctctgtacgtgggggacctgcacccc
gacgtgaccgaggcgatgctctacgagaagttcagcccggccgggcccatcctctccatc
cgggtctgcagggacatgatcacccgccgctccttgggctacgcgtacgtgaacttccag
cagccggcggacgcggaacgtgctttggacaccatgaattttgatgttataaagggcaag
ccagtacgcatcatgtggtctcagcgtgatccatcacttcgcaaaagtggagtaggcaac
atattcattaaaaatttggacaaatccatcgacaataaagcactatatgatacgttttct
gcgtttggtaacatcctttcatgtaaggtggtttgtgatgaaaatggctccaagggctat
ggatttgtacactttgaaacacaggaagcagctgaaagagctattgaaaaaatgaatggg
atgcttctaaatgatcgtaaagtgtttgttggacgatttaaatctcggaaggaacgagaa
gcagagcttggagccagggcaaaggagttcaccaatgtttacatcaagaactttggagaa
gacatggatgatgagcgccttaaggaactctttggcaagtttgggcctgccttaagtgtg
aaagtaatgacagatgaaagtggaaaatccaaaggatttggatttgtaagctttgaaagg
catgaagatgcgcagaaagctgtggatgagatgaatgggaaggagctcaatggaaaacag
atttatgttggacgagctcagaaaaaagtggaacggcagacggaacttaagcgcaaattt
gagcagatgaagcaagataggatcaccagatatcagggtgtgaacctttatgtgaaaaat
cttgatgacgggattgatgatgagcgtctccggaaggagttttctccgtttggtacaatc
accagtgcaaaagtaatgatggagggtgggcgcagcaaagggtttggttttgtatgtttc
tcatcccctgaagaagccactaaagcagttacagagatgaatggtagaattgtggccacg
aagccactgtatgtagctttagctcagcgcaaagaagagcgccaggctcacctcactaac
cagtatatgcagaggatggcaagtgtacgagctgtgcccaaccccgtgatcaacccctac
cagccagcacctccttcaggttacttcatggcagctatcccacagactcagaaccgtgct
gcatactatcctcctagccaaattgctcaactaagaccaagtcctcgctggactgctcag
ggtgccagacctcatccattccagaatatgcccggtgctatccgcccagctgctcctaga
ccaccatttagtacgatgagaccagcttcctcacaggttccacgagtcatgtcaacacag
cgtgttgctaacacatcaacacagacaatgggtccacgtcctgcagctgctgctgctgca
gccactcctgctgtccgcaccgttccccagtataaatatgctgcgggagtccgcaatccc
cagcaacatcttaatgcacagccacaagttaccatgcaacagcctgctgttcatgtgcaa
ggtcaagaacctttaactgcttccatgttggcatctgcgcccccgcaagagcagaagcaa
atgttgggtgaacggctgtttcctcttatccaagccatgcacccttctcttgctggtaaa
atcactggcatgctgttggagattgataactcagaattacttcacatgctcgagtctcca
gagtctctccgctcaaaggttgatgaagctgtagctgtactacaagcccaccaagcgaaa
gaggctgcccagaaagcagtgaacagtgccactggtgttccaactgtctaa

KEGG   Mus musculus (mouse): 18459
Entry
18459             CDS       T01002                                 

Gene name
Pabpc2, Pa, Pabp, Pabp+, Pabp2
Definition
(RefSeq) poly(A) binding protein, cytoplasmic 2
  KO
K13126  polyadenylate-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu03015  mRNA surveillance pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    18459 (Pabpc2)
   03015 mRNA surveillance pathway
    18459 (Pabpc2)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    18459 (Pabpc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    18459 (Pabpc2)
   03041 Spliceosome [BR:mmu03041]
    18459 (Pabpc2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     18459 (Pabpc2)
   mRNA cycle factors
    Stress granule specific factors
     18459 (Pabpc2)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   Complex C specific factors
    18459 (Pabpc2)
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_occluded RRM_3 HATPase_c
Other DBs
NCBI-GeneID: 18459
NCBI-ProteinID: NP_035163
MGI: 1349723
Ensembl: ENSMUSG00000051732
Vega: OTTMUSG00000020288
UniProt: Q62029
Position
18; 18 B3
AA seq 628 aa
MNSSDPGCPMASLYVGDLHPDVTEAMLYEKFSSAGPILSIRVYRDVITRRSLGYASVNFE
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRRSGVGNVFIKNLNKTIDNKALYDTFS
AFGNILSCKVVSDENGSKGHGFVHFETEEAAERAIEKMNGMLLNDRKVFVGRFKSQKERE
AELGTGTKEFTNVYIKNFGDRMDDETLNGLFGRFGQILSVKVMTDEGGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKHIYVGRAQKKDDRHTELKHKFEQVTQDKSIRYQGINLYVKN
LDDGIDDERLQKEFSPFGTITSTKVMTEGGRSKGFGFVCFSSPEEATKAVSEMNGRIVAT
KPLYVALAQRKEERQAHLTNQYIQRMASVRSGPNPVNPYQPASSSYSVAAVPQTQNCVPC
CPSQIAQPRPSARWIAQGSRPHPFPNVPGAIHPAAPRSSLTTVRPSSSHVQVTTAHRITN
TSAQITGQRPAPASSATATPVHSIPQYKYAAGVQNSQQHLNAQLAQQPAVCIQGQEPWTA
SMLVTAPQEPKQMLGERLFPLIQAMHPTLAGKITGMLLDIDNSEPLRMLESPVSRCSRAE
EAVATLQAHQVKEAAQKAVGSTSGVPTV
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgaactccagcgacccaggctgtcccatggcctcgctctatgtgggggacctgcaccct
gatgtgactgaggcgatgctctatgagaagttcagctctgccgggcccatcctttccatc
cgggtatacagggacgtgatcacacgccgttccctgggctatgcttccgtgaactttgag
cagcctgctgatgcagagcgagctttggacaccatgaattttgatgtcatcaagggcaag
ccggtccgcatcatgtggtctcagcgtgatccatcacttcgcaggagtggagtaggcaat
gtgttcattaaaaatttgaacaagaccattgataataaagcactgtatgatacattctct
gcttttggcaatatcctttcctgcaaggtggttagcgatgagaatggctccaagggccac
ggatttgtacattttgagacagaggaggcagcagaaagagccatcgagaaaatgaacggg
atgcttctgaatgaccgcaaagtgtttgttggacggtttaagtctcagaaagaacgagaa
gccgagcttggaacggggaccaaggagtttaccaacgtttacatcaagaactttggggac
cgcatggatgacgagaccctgaatggcctctttggcaggtttggacagatcttaagtgtg
aaagtcatgaccgatgaaggtgggaaatcgaaaggattcgggttcgtcagctttgaaagg
catgaagatgcgcagaaagcggtggacgagatgaatggtaaagaactcaatggaaaacac
atttatgttggtcgagcgcagaaaaaagatgaccgtcacacagaacttaaacacaaattt
gaacaggtgacacaagataagagcatcagatatcagggcattaacctttatgtgaaaaat
cttgatgatggcattgatgatgaacggctccagaaagaattttctccatttggaacaatc
accagtacaaaggttatgacagagggtggtcgcagtaaaggattcggttttgtgtgtttc
tcctccccggaagaagccacaaaagctgtttcagaaatgaatgggagaattgtggccacg
aaaccactttatgtagctttagcccagcgcaaagaagaacgtcaggctcacctcactaac
caatatattcaaagaatggcaagtgtacgatctgggccgaaccctgttaacccctaccaa
ccagcatcttccagttactctgtggccgctgtcccacagactcagaactgcgttccatgc
tgccctagccaaattgctcaaccaaggccaagtgctcgctggattgctcagggttcccgg
cctcatccattccccaatgtgcctggtgctatccacccagctgctcctagatcgtcgttg
actactgtaagaccaagctcttcacacgttcaagtcacgacagcacatcgcattactaac
acatcagcacagataacaggtcagcgtcctgccccagcctcttcagctacagcgactcct
gttcactcgattccacagtacaagtatgctgcaggagtccagaactcccagcaacatctt
aatgcccagctggcgcaacagcccgctgtttgcatacagggtcaggaaccttggactgct
tccatgttagtaaccgctcctcaagagccgaagcaaatgctgggtgaaaggctattccct
ctcatccaagccatgcacccgactctggctggtaagatcacgggcatgttgctggacatt
gataactcggaaccacttcgtatgcttgaatctccagtgtctcggtgttctagggctgag
gaagccgtggccacactccaagcccaccaagttaaagaggctgcccagaaagctgttggc
agtacctctggtgtcccaactgtttaa

KEGG   Mus musculus (mouse): 230721
Entry
230721            CDS       T01002                                 

Gene name
Pabpc4
Definition
(RefSeq) poly(A) binding protein, cytoplasmic 4
  KO
K13126  polyadenylate-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu03015  mRNA surveillance pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    230721 (Pabpc4)
   03015 mRNA surveillance pathway
    230721 (Pabpc4)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    230721 (Pabpc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    230721 (Pabpc4)
   03041 Spliceosome [BR:mmu03041]
    230721 (Pabpc4)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     230721 (Pabpc4)
   mRNA cycle factors
    Stress granule specific factors
     230721 (Pabpc4)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   Complex C specific factors
    230721 (Pabpc4)
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_3
Other DBs
NCBI-GeneID: 230721
NCBI-ProteinID: NP_001343306
MGI: 2385206
Ensembl: ENSMUSG00000011257
Vega: OTTMUSG00000008978
Position
4; 4 D2.2
AA seq 627 aa
MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVMKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGAKAKEFTNVYIKNFGEEVDDGNLKELFSQFGKTLSVKVMRDSSGKSKGFGFVSYEK
HEDANKAVEEMNGKEMSGKAIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKN
LDDTIDDEKLRREFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGS
KPLYVALAQRKEERKAHLTNQYMQRVAGMRALPASAILNQFQPAAGGYFVPAVPQAQGRP
PYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSALRQSGPRPALRHLAPTGNAPASRGLPTT
AQRVGVPTAVPNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEP
LTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLR
SKVDEAVAVLQAHHAKKEAAQKESKAK
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgaacgctgcagccagcagctaccccatggcctccttatacgtgggcgatttgcactcg
gacgtcaccgaagccatgctgtatgaaaagtttagccctgcggggcctgtgctgtccatc
cgggtctgtcgcgatatgatcacccggcgctctctgggttatgcctacgtcaacttccag
cagccagctgacgctgagagggccttggacaccatgaacttcgacgtgatgaagggaaag
ccgatccgcatcatgtggtcgcagagggatccctcgttgagaaaatctggggtgggaaat
gtcttcatcaagaacctggacaaatccatagacaacaaggcactgtatgacactttctct
gcctttggaaacatcttgtcctgtaaggtggtctgtgatgagaacggctctaagggctat
gcttttgttcacttcgagacccaagaggccgccgacaaggccatcgagaagatgaatggc
atgcttctcaatgaccgtaaagtgttcgtgggtagattcaagtctcgcaaagagcgggaa
gcggagcttggagccaaggccaaggaattcaccaatgtttatatcaaaaactttggagaa
gaggtggatgatgggaatctgaaagagctcttcagccagtttggtaagaccctaagtgtc
aaggtgatgagagactccagtgggaagtccaaaggctttggctttgtaagttacgagaaa
cacgaggatgccaataaggctgtggaagaaatgaatggaaaggaaatgagcgggaaagcc
atatttgtaggccgtgcacagaaaaaggtagaaaggcaggctgagctgaagcggaagttt
gagcagctcaagcaggagaggattagccggtaccagggggtgaatctctacattaagaac
ttggatgacaccattgatgatgagaaattgaggagagagttttctccctttggatcaatc
accagcgcgaaggtgatgctagaagatgggagaagcaaagggtttggctttgtctgtttc
tcctctcctgaagaggcgaccaaagctgtcaccgagatgaatggacgcattgtgggctcc
aagcctctgtacgtcgccctggcccagaggaaggaagagcggaaggctcatctgaccaac
cagtacatgcagcgtgtggcggggatgagagcactccctgccagtgccatcttaaatcag
ttccagcctgcagctggtggctattttgtgcctgcagttccgcaggctcagggaagaccc
ccatattacacgcctaaccagttagcacagatgaggcctaatccacgctggcagcaaggc
gggagacctcaaggcttccaaggaatgccaagtgccctgcggcagtctgggcctcgtcca
gctcttcgacatctggctccaactggtaatgctccggcctctcgtggccttcctactact
gctcagagagtcggcgtccctacagccgtgccaaaccttgcacctcgggccgcagttgct
gccgccgctcccagggctgtggctccatacaagtacgcctccagtgtccgcagcccacac
cctgccatccagccgctgcaggccccccagcctgcagtccacgtccagggtcaggagccc
ctgactgcctccatgcttgctgcagcgcccccccaggagcagaagcagatgctgggggag
cgtctgttcccgcttatccaaacaatgcattcaaacctggctgggaaaatcaccgggatg
ctgctggaaatcgacaactctgagctgctgcacatgctggagtcccccgagtccctccgc
tccaaggtagatgaagcggtggcagtcctgcaggctcaccatgccaagaaagaagctgcc
cagaaggagtcgaaagccaaataa

KEGG   Mus musculus (mouse): 241989
Entry
241989            CDS       T01002                                 

Gene name
Pabpc4l, C330050A14Rik, EG241989
Definition
(RefSeq) poly(A) binding protein, cytoplasmic 4-like
  KO
K13126  polyadenylate-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu03015  mRNA surveillance pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    241989 (Pabpc4l)
   03015 mRNA surveillance pathway
    241989 (Pabpc4l)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    241989 (Pabpc4l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    241989 (Pabpc4l)
   03041 Spliceosome [BR:mmu03041]
    241989 (Pabpc4l)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     241989 (Pabpc4l)
   mRNA cycle factors
    Stress granule specific factors
     241989 (Pabpc4l)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   Complex C specific factors
    241989 (Pabpc4l)
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_occluded RRM_7 Nup35_RRM Nup35_RRM_2 Limkain-b1 Ham1p_like RRM_3 RB_A
Other DBs
NCBI-GeneID: 241989
NCBI-ProteinID: NP_001094949
MGI: 3643087
Ensembl: ENSMUSG00000090919
Vega: OTTMUSG00000051437
UniProt: G5E8X2
Position
3; 3 B
AA seq 370 aa
MSLEAKYRAASLYVGDLHEDVTEDMLFRKFSTVGPVLSIRICRDLISQRSLGYAYVNFLQ
VNDAQKALVTMNFDVIKGKSIRLMWSQRDACLRRSGVGNVFIKNLDKSIDNKTLYEHFSP
FGTIMSSKVMTDGEGSKGYGFVHYQDRRAADRAIEEMNGKLLRESTLFVARFKSRKDREA
ELRDKPTEFTNVYIKNFGDDVDDEKLREVFSKYGQTLSVKVMKDATGKSKGFGFVSFDSH
EAAKNAVEDMNGQDINGQTIFVGRAQKKVERQAELKEMFEQMKKERIRARQAAKLYIKNL
DDTIDDETLRKEFSVFGSICRVKVMQEAGQSKGFGLICFFSPEAAAKAMAEMNGRILGSK
PLNIALGQKH
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgagtctggaagctaagtaccgtgcagcttccctctacgtgggtgacctccacgaagat
gtcacggaggacatgctcttcaggaagttcagcacagtggggccggtgttgtccatccga
atctgcagggacctgatttcccaacgttcactaggctacgcctatgtcaattttctccag
gttaatgatgcccagaaggccttagtcaccatgaactttgacgtgatcaaaggtaaatcc
attcgtctcatgtggtctcaacgggatgcttgcctgaggagatcgggagtcgggaatgtg
tttatcaagaatctggacaaatccattgataacaaaaccttgtatgaacacttctcacct
tttggaacgatcatgtcttccaaggtgatgactgatggagaaggctccaagggctatggc
ttcgtgcactaccaggaccggagagcggcagacagggccattgaggagatgaatggcaag
ctgctgagggagagcactttgttcgtggccagattcaaaagccgtaaggatcgggaggct
gagctcagagacaaaccaaccgagttcactaatgtgtatatcaaaaactttggagatgac
gtagatgatgagaagctcagggaagttttcagcaaatatggccaaactttgagtgttaag
gtgatgaaagatgccactgggaagtccaaaggctttggatttgtgagttttgatagccac
gaggctgcgaaaaacgcagttgaagacatgaatggacaggacataaacgggcagacgatt
tttgtaggcagagcccagaagaaggtagaacgacaggctgagttaaaggaaatgtttgag
cagatgaaaaaggaaagaatccgtgcacgccaggcagctaagctctacattaagaacctg
gatgacaccatcgatgatgaaacactgcgcaaggaattttcagtctttgggtccatttgc
agggttaaagtgatgcaggaagcagggcagagcaaaggctttggcttaatctgcttcttc
tccccggaggcagcggcgaaagcaatggctgagatgaacggccgcatccttggctccaaa
cccctcaacattgcactgggacagaagcactga

KEGG   Mus musculus (mouse): 245545
Entry
245545            CDS       T01002                                 

Gene name
Pabpc1l2a, EG245545, Pabpc1l2a-ps, Rbm3, Rbm32a
Definition
(RefSeq) poly(A) binding protein, cytoplasmic 1-like 2A
  KO
K13126  polyadenylate-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu03015  mRNA surveillance pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    245545 (Pabpc1l2a)
   03015 mRNA surveillance pathway
    245545 (Pabpc1l2a)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    245545 (Pabpc1l2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    245545 (Pabpc1l2a)
   03041 Spliceosome [BR:mmu03041]
    245545 (Pabpc1l2a)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     245545 (Pabpc1l2a)
   mRNA cycle factors
    Stress granule specific factors
     245545 (Pabpc1l2a)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   Complex C specific factors
    245545 (Pabpc1l2a)
SSDB
Motif
Pfam: RRM_1 RRM_5 Nup35_RRM
Other DBs
NCBI-GeneID: 245545
NCBI-ProteinID: NP_001371195
MGI: 3645788
Ensembl: ENSMUSG00000086524
Position
X; X D
AA seq 229 aa
MDEELAAALAAEEEEAAAGGSDDGNPDFPTASLYVGDLHPEVTESMLYEKFSPAGPILSI
RICRDKVTRRSLGYAYVNYQQPVDAKRALETMNFDVINGRPVRIMWSQRDPSLRKSGVGN
VFIKNLGKTIDNKALYNIFSAFGNILSCKVACDEKGPKGYGFVHFQKQESAERAIDALNG
MFLNYRKIFVGRFKSHKEREAERGAWARQSTSADFKDFDDDSDDEATFR
NT seq 690 nt   +upstreamnt  +downstreamnt
atggacgaagagctggcagcagccttggctgcagaggaggaagaggcggcggccgggggc
tcggacgatgggaacccagactttcccacggcctcgctgtacgtgggcgacctgcacccc
gaggtgaccgagtccatgctgtatgagaagttcagccctgccgggcccatcctgtccatc
cgcatctgcagggacaaggtcacccggcgctctctgggctacgcatatgtcaactaccag
caaccggtggacgccaagcgggccctggagaccatgaactttgacgttatcaatggccgg
ccagtgcgcatcatgtggtcccagagggacccgtcgctccgcaagagcggggtgggcaac
gtcttcatcaagaacctgggcaagaccatcgacaacaaggcgctgtacaacatcttctcg
gcctttggcaacatcctgtcctgcaaggtggcctgtgacgaaaaggggcccaagggctat
gggttcgtgcacttccagaagcaggagtcggccgagcgggccatagatgcgctgaatggc
atgttcctgaactaccgcaagattttcgtggggagattcaagtcccacaaggagagagag
gccgaaaggggagcctgggcgcgccagtccaccagcgctgacttcaaggatttcgacgac
gactccgatgacgaggccacctttcgatga

KEGG   Mus musculus (mouse): 381404
Entry
381404            CDS       T01002                                 

Gene name
Pabpc1l, 1810053B01Rik, Epab, eP
Definition
(RefSeq) poly(A) binding protein, cytoplasmic 1-like
  KO
K13126  polyadenylate-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu03015  mRNA surveillance pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    381404 (Pabpc1l)
   03015 mRNA surveillance pathway
    381404 (Pabpc1l)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    381404 (Pabpc1l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    381404 (Pabpc1l)
   03041 Spliceosome [BR:mmu03041]
    381404 (Pabpc1l)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     381404 (Pabpc1l)
   mRNA cycle factors
    Stress granule specific factors
     381404 (Pabpc1l)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   Complex C specific factors
    381404 (Pabpc1l)
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_occluded SET_assoc RRM_3 Limkain-b1 E2R135
Other DBs
NCBI-GeneID: 381404
NCBI-ProteinID: NP_001107551
MGI: 1922908
Ensembl: ENSMUSG00000054582
Vega: OTTMUSG00000016137
UniProt: A2A5N3
Position
2; 2 H3
AA seq 607 aa
MDTGGHGCSLSSLYVGDLHPDVTESMLYEMFSPIGNILSIRVCRDVATRRSLGYAYINFQ
QPADAERALDTMNFEVIKGQPIRIMWSHRDPGLRKSGMGNIFIKNLENSIDNKALYDTFS
TFGSILSSKVVYNEHGSRGFGFVHFETHEAAQKAINTMNGMLLNDRKVFVGHFKSRQKRE
AELGARALGFTNIYVKNLHANVDEQRLQDLFSQFGNMQSVKVMRDSNGQSRGFGFVNFEK
HEEAQKAVDHMNGKEVSGQLLYVGRAQKRAERQSELKRRFEQMKQERQNRYQGVNLYVKN
LDDSINDERLKEVFSTYGVITSAKVMTESSHSKGFGFVCFSSPEEATKAVTEMNGRIVGT
KPLYVALAQRKEERKAILTNQYRRRPSHPVLSSFQQPTSYLLPAVPQSTAQAVYYSSGSI
TPMQPDPRWTAQPHGPPSTCPPAASVVQPLSTTQHPCIHLRGASQVSSQVPHTQRVVNIG
TQTTGPGGEGSSIPGQLLVPHRGTSAVHSAHGVQESAVYVPGHQPLTVSMLAAAPLHEQK
QMIGERLYSLIHDACAPLTGKITGMLLELDNLELLLLLESPESLHAKIEEAVAVLQVHRE
MESTDRN
NT seq 1824 nt   +upstreamnt  +downstreamnt
atggacacaggtggccatggctgctcactctcctcgctctatgtgggcgatctgcacccc
gacgtgactgaatctatgctctatgagatgttctccccgatcggcaatatcctttccatc
cgcgtgtgtcgggatgtggctacccggcgctctctgggctatgcctacatcaatttccag
cagcctgctgacgcggaacgggcactagacacaatgaactttgaggtgatcaaaggccag
cccatccgaatcatgtggtcccaccgagacccaggccttcggaagtctggtatgggcaac
atctttatcaaaaacttggagaattccatcgacaacaaggctctgtatgacaccttctct
acttttgggagcattctctcttctaaggtagtatacaatgaacatggatcgcggggtttc
ggctttgtgcatttcgagacccacgaggctgcccagaaggccatcaacaccatgaatggg
atgttgctgaacgaccggaaagtctttgtaggccatttcaagtctcgacagaagcgggag
gcagagctgggggctcgggccctcgggttcaccaacatctatgtgaagaacctgcacgcg
aacgtggacgagcagaggctccaggacctcttctcccagtttggaaatatgcagagtgtg
aaggtgatgagagacagcaatgggcaatcccggggcttcggctttgtcaactttgagaag
catgaggaagcccagaaggccgtggaccacatgaatgggaaggaggtgagcgggcagctg
ctctatgtgggtcgggcccagaagcgggcagaacggcagagcgagctgaagcgcaggttt
gaacaaatgaagcaggagaggcagaaccgctaccagggtgtgaacctttatgtgaagaac
ctggacgactccattaatgatgagaggctgaaggaagttttctctacctatggcgtgatc
accagcgctaaggtgatgacagaaagtagccacagcaagggctttggctttgtgtgcttt
tcctctccagaagaggcaacgaaggccgtgacggagatgaacgggcgcatcgtgggcacg
aaaccgctctatgtggccctggcacagcgcaaggaggagcggaaggccatcttgaccaac
cagtataggcgacgcccctctcaccctgtcttgagctccttccagcagcctaccagctac
ctgctccctgctgtaccccagtctacagcccaggctgtgtactacagttctggctccata
actccaatgcaacctgaccccaggtggacagcccagccacatggacctccatctacctgc
cctccagctgcctctgtggtccagcctctaagcacgacgcagcatccctgtatccacctg
aggggtgccagccaggtctccagccaggtgcctcacacgcagagagtagtcaacattggt
acccagactacaggaccaggtggggagggatcctctatcccaggccagcttctcgtgcca
catagaggaacctcagctgtacacagtgcccatggggtccaggagtcggccgtgtatgtc
cctggccatcagcctctgactgtgtccatgctggccgctgcacccctacacgagcaaaag
cagatgattggggagcgtctctactccctcatccacgatgcctgcgccccactgactggc
aagatcacgggcatgctgctggagctggacaacctggagcttctgttattgctggagtcc
ccagagtccctccatgccaagatagaagaggcggtggcagtactgcaggtgcatcgagaa
atggagtcaacagataggaactga

KEGG   Mus musculus (mouse): 668382
Entry
668382            CDS       T01002                                 

Gene name
Pabpc1l2b, EG668382, Pabpc1l2b-ps, Rbm32, Rbm32b
Definition
(RefSeq) poly(A) binding protein, cytoplasmic 1-like 2B
  KO
K13126  polyadenylate-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu03015  mRNA surveillance pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    668382 (Pabpc1l2b)
   03015 mRNA surveillance pathway
    668382 (Pabpc1l2b)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    668382 (Pabpc1l2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    668382 (Pabpc1l2b)
   03041 Spliceosome [BR:mmu03041]
    668382 (Pabpc1l2b)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     668382 (Pabpc1l2b)
   mRNA cycle factors
    Stress granule specific factors
     668382 (Pabpc1l2b)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   Complex C specific factors
    668382 (Pabpc1l2b)
SSDB
Motif
Pfam: RRM_1 RRM_5 Nup35_RRM
Other DBs
NCBI-GeneID: 668382
NCBI-ProteinID: NP_001371196
MGI: 3644774
Position
X; X D
AA seq 229 aa
MDEELAAALAAEEEEAAAGGSDDGNPDFPTASLYVGDLHPEVTESMLYEKFSPAGPILSI
RICRDKVTRRSLGYAYVNYQQPVDAKRALETMNFDVINGRPVRIMWSQRDPSLRKSGVGN
VFIKNLGKTIDNKALYNIFSAFGNILSCKVACDEKGPKGYGFVHFQKQESAERAIDALNG
MFLNYRKIFVGRFKSHKEREAERGAWARQSTSADFKDFDDDSDDEATFR
NT seq 690 nt   +upstreamnt  +downstreamnt
atggacgaagagctggcagcagccttggctgcagaggaggaagaggcggcggccgggggc
tcggacgatgggaacccagactttcccacggcctcgctgtacgtgggcgacctgcacccc
gaggtgaccgagtccatgctgtatgagaagttcagccctgccgggcccatcctgtccatc
cgcatctgcagggacaaggtcacccggcgctctctgggctacgcatatgtcaactaccag
caaccggtggacgccaagcgggccctggagaccatgaactttgacgttatcaatggccgg
ccagtgcgcatcatgtggtcccagagggacccgtcgctccgcaagagcggggtgggcaac
gtcttcatcaagaacctgggcaagaccatcgacaacaaggcgctgtacaacatcttctcg
gcctttggcaacatcctgtcctgcaaggtggcctgtgacgaaaaggggcccaagggctat
gggttcgtgcacttccagaagcaggagtcggccgagcgggccatagatgcgctgaatggc
atgttcctgaactaccgcaagattttcgtggggagattcaagtcccacaaggagagagag
gccgaaaggggagcctgggcgcgccagtccaccagcgctgacttcaaggatttcgacgac
gactccgatgacgaggccacctttcgatga

KEGG   Mus musculus (mouse): 67543
Entry
67543             CDS       T01002                                 

Gene name
Pabpc6, 4932702K14Rik, AI428050, Pabpc3
Definition
(RefSeq) poly(A) binding protein, cytoplasmic 6
  KO
K13126  polyadenylate-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu03015  mRNA surveillance pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    67543 (Pabpc6)
   03015 mRNA surveillance pathway
    67543 (Pabpc6)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    67543 (Pabpc6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    67543 (Pabpc6)
   03041 Spliceosome [BR:mmu03041]
    67543 (Pabpc6)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     67543 (Pabpc6)
   mRNA cycle factors
    Stress granule specific factors
     67543 (Pabpc6)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   Complex C specific factors
    67543 (Pabpc6)
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_occluded HATPase_c ATP-grasp_2
Other DBs
NCBI-GeneID: 67543
NCBI-ProteinID: NP_001157308
MGI: 1914793
Ensembl: ENSMUSG00000046173
UniProt: Q9D4E6
Position
17; 17 A1
AA seq 643 aa
MNPSDPSYSLASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVYRDRITRRSLGYASVNFQ
QLEDAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFVKNLDRSIDSKTLYDTFS
AFGNILSCKVVCDENGSKGYGFVHFETQEEAERAIEKMNGMFLNDHKVFVGRFKSRRDRQ
AELGARAKEFTNVYIKNLGEDMDDERLQDLFGRFGPALSVKVMTDESGKSKGFGFVSFER
HEDARKAVEEMNGKDLNGKQIYVGRAQKKVERQTELKHKFGQMKQDKHKIERVPQDRSVR
CKGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVTMEGGRSKGFGFVCFSSPEEATKAV
TEMNGKIVATKPLYVALAQRKEERQAHLSNQYMQRMASTSAGPNPVVSPFQPAQGPSGYC
MTATPTQSRRAYCAPNQTTQQGPSARGSAHGTRAHPFQNMSSTIHPSHTMPSFSTSGPTT
SQAIRHRTASTSTQMMGPHPAAAAAAAAAPATRTITQYKYTAGVRNPPQHPNTQPHVSTQ
RSAVPVQGKESLTASMLASAPPQAQKQMLGEWLFSLIQAMHPALAGKITGMLLEIDNIEL
RHMLESPECLHTKVDEAIAVLQAHQAKETSQKAVSSVAGVPNA
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgaaccccagcgaccccagctactctttggcttcactctatgtgggggacctgcatccc
gacgtgaccgaggcgatgctctatgagaagttcagcccggcagggcccatcctctccatc
cgggtgtacagggacaggatcacccgccgctcgctgggctacgcgtccgtcaacttccag
cagctggaggacgccgagcgggccttggacaccatgaatttcgacgtgataaagggcaag
ccggttcgcatcatgtggtctcagcgggacccgtcgctgcgcaagagcggagtagggaac
atatttgtgaaaaatctggacagatccattgacagtaaaacgctgtatgatacgttttct
gcctttggtaacatcctttcctgtaaggtggtgtgtgatgagaatggctccaagggttac
ggctttgtacacttcgagacacaggaagaagctgaacgagcaattgagaaaatgaacggg
atgttcctaaatgaccacaaagtgttcgttggtcgctttaagtctcgtagagacaggcag
gctgaacttggagccagggccaaggagttcaccaatgtttacatcaagaatttgggagaa
gatatggatgatgagagactccaggatctatttggcagatttgggcctgccttaagtgtt
aaagtcatgactgatgaaagtggaaaatccaaaggattcggattcgtaagctttgaaagg
catgaagatgcacgaaaggcagtggaagagatgaatggaaaagacctcaatggaaaacaa
atttatgtaggtcgtgctcagaaaaaggtggaacgacagactgaactgaagcacaaattc
gggcagatgaagcaagataagcacaaaattgaacgggtaccacaagatagaagcgtcaga
tgcaaaggtgttaacctctatgtgaaaaaccttgatgatggtatcgatgatgagcgtctc
cggaaggagttttccccttttggtacgattactagtgcaaaggtaacgatggagggtggg
cgcagcaaagggtttggttttgtatgtttttcctctccagaagaagccaccaaagctgtt
acagaaatgaatggtaaaatagtggccaccaaaccactctacgtagctttagctcaacgc
aaagaggagcgccaggctcacctcagtaaccagtacatgcaaagaatggcaagcaccagt
gccgggcctaacccagtcgtcagccctttccagccagcgcaggggccgtcaggttactgc
atgacagctacaccaactcagagccgtagggcatactgtgctcctaatcagactactcag
caaggaccaagtgcccgtgggagtgctcacggtaccagagctcatccattccaaaacatg
tctagtaccatccacccatcacatactatgccatcatttagtacttcaggacccactacc
tcacaggctatacgacatcgtactgccagcacatccacacagatgatgggcccacatcct
gcagctgctgctgctgctgcagctgctcctgccacccgcacaattacccagtataaatat
actgctggagtccgaaatccccctcagcatcctaatacacagccacatgtcagcacgcag
cggtctgctgttcctgtccaaggtaaagagtctttgactgcctccatgttggcctctgct
cctcctcaagctcaaaagcaaatgttaggggaatggctcttctctcttattcaggccatg
caccctgcccttgctggtaaaatcacgggtatgctgttggaaattgataatatagagcta
cgccacatgcttgagtctccagagtgtctccacaccaaagttgatgaagccatagctgta
ctgcaagctcaccaagctaaagagacttcacagaaagcagtcagcagtgttgctggtgtc
ccaaatgcttaa

KEGG   Mus musculus (mouse): 93728
Entry
93728             CDS       T01002                                 

Gene name
Pabpc5, C820015E17
Definition
(RefSeq) poly(A) binding protein, cytoplasmic 5
  KO
K13126  polyadenylate-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu03015  mRNA surveillance pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    93728 (Pabpc5)
   03015 mRNA surveillance pathway
    93728 (Pabpc5)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    93728 (Pabpc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    93728 (Pabpc5)
   03041 Spliceosome [BR:mmu03041]
    93728 (Pabpc5)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     93728 (Pabpc5)
   mRNA cycle factors
    Stress granule specific factors
     93728 (Pabpc5)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   Complex C specific factors
    93728 (Pabpc5)
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_occluded DUF4523 RRM_3 TC1
Other DBs
NCBI-GeneID: 93728
NCBI-ProteinID: NP_444344
MGI: 2136401
Ensembl: ENSMUSG00000034732
Vega: OTTMUSG00000018505
UniProt: Q8C7D3
Position
X; X E1
AA seq 381 aa
MSGEPNTAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGY
GYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKTIDNRA
LFYLFSAFGNILSCKVVCDDNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRFK
FPEERAAEVRTRERATFTNVFVKNFGDDIDDEKLNKLFSEYGPTESVKVIRDATGKSKGF
GFVRYETHEAAQKAVLELHGKSIDGKVLCVGRAQKKIERLAELRRRFERLKLKEKNRPSG
VPIYIKNLDETINDEKLKEEFSSFGSISRAKVMMEVGQGKGFGVVCFSSFEEACKAVDEM
NGRIIGSKTLHVTLGQARHRW
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgagtggggagcctaatactgctggcaagaaaaagaagtacctcaaggctgccctgtat
gtaggtgacttggaccctgacgtcacagaggacatgctctataagaagttcagacctgct
ggccctctgcgcttcactagaatctgtcgtgacccagtgacccgcagccccctgggttat
ggttatgttaatttccgctttcctgcagatgctgaatgggcattgaacacaatgaatttt
gatttaattaatggtaaaccatttcgcctcatgtggtcacagccagatgaccgtttaaga
aagtctggagttggaaatatattcatcaaaaacttggataagaccatagacaatagggcc
ttattttatttattttcggcttttgggaacattctttcctgtaaagtcgtatgtgatgac
aatggctctaagggttatgcttatgtccacttcgatagccttgctgctgccaatagggct
atctggcacatgaatggagtgcggctcaataaccgccaggtatatgttggtcgattcaaa
tttcctgaagagagagcagcagaagtcagaaccagagaaagagcaacatttaccaatgtt
ttcgtaaaaaactttggagatgacattgatgatgaaaaactaaacaaacttttcagtgaa
tatgggccaactgagagtgttaaagtcataagagatgccactgggaaatctaaaggcttt
ggatttgtaagatatgaaacacatgaagctgcccaaaaggctgtgctagaactgcatggc
aagtcaatagatgggaaagtcctatgtgtagggagagcacagaagaaaattgaacgcctg
gctgaattaaggcggagatttgaacggctgaaattaaaagaaaaaaataggccttcagga
gtgcctatctatattaagaacttggatgagaccatcaatgatgagaaactaaaggaggaa
ttttcttcatttggatcaatcagtcgagccaaagtgatgatggaagtgggacaaggaaaa
gggtttggtgttgtctgcttttcttcttttgaagaggcgtgcaaagcagtggatgaaatg
aatggtcgcataataggctccaagacattgcatgtcactctggggcaagctaggcacagg
tggtga

DBGET integrated database retrieval system