KEGG   Mus musculus (house mouse): 18459
Entry
18459             CDS       T01002                                 
Symbol
Pabpc2, Pabp, Pabp+, Pabp2
Name
(RefSeq) poly(A) binding protein, cytoplasmic 2
  KO
K13126  polyadenylate-binding protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    18459 (Pabpc2)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    18459 (Pabpc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    18459 (Pabpc2)
   03041 Spliceosome [BR:mmu03041]
    18459 (Pabpc2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     18459 (Pabpc2)
   mRNA cycle factors
    Stress granule specific factors
     18459 (Pabpc2)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   Complex C specific factors
    18459 (Pabpc2)
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_occluded YflT RRM_3 HATPase_c
Other DBs
NCBI-GeneID: 18459
NCBI-ProteinID: NP_035163
MGI: 1349723
Ensembl: ENSMUSG00000051732
UniProt: Q62029
Position
18:39906550..39909135
AA seq 628 aa
MNSSDPGCPMASLYVGDLHPDVTEAMLYEKFSSAGPILSIRVYRDVITRRSLGYASVNFE
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRRSGVGNVFIKNLNKTIDNKALYDTFS
AFGNILSCKVVSDENGSKGHGFVHFETEEAAERAIEKMNGMLLNDRKVFVGRFKSQKERE
AELGTGTKEFTNVYIKNFGDRMDDETLNGLFGRFGQILSVKVMTDEGGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKHIYVGRAQKKDDRHTELKHKFEQVTQDKSIRYQGINLYVKN
LDDGIDDERLQKEFSPFGTITSTKVMTEGGRSKGFGFVCFSSPEEATKAVSEMNGRIVAT
KPLYVALAQRKEERQAHLTNQYIQRMASVRSGPNPVNPYQPASSSYSVAAVPQTQNCVPC
CPSQIAQPRPSARWIAQGSRPHPFPNVPGAIHPAAPRSSLTTVRPSSSHVQVTTAHRITN
TSAQITGQRPAPASSATATPVHSIPQYKYAAGVQNSQQHLNAQLAQQPAVCIQGQEPWTA
SMLVTAPQEPKQMLGERLFPLIQAMHPTLAGKITGMLLDIDNSEPLRMLESPVSRCSRAE
EAVATLQAHQVKEAAQKAVGSTSGVPTV
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgaactccagcgacccaggctgtcccatggcctcgctctatgtgggggacctgcaccct
gatgtgactgaggcgatgctctatgagaagttcagctctgccgggcccatcctttccatc
cgggtatacagggacgtgatcacacgccgttccctgggctatgcttccgtgaactttgag
cagcctgctgatgcagagcgagctttggacaccatgaattttgatgtcatcaagggcaag
ccggtccgcatcatgtggtctcagcgtgatccatcacttcgcaggagtggagtaggcaat
gtgttcattaaaaatttgaacaagaccattgataataaagcactgtatgatacattctct
gcttttggcaatatcctttcctgcaaggtggttagcgatgagaatggctccaagggccac
ggatttgtacattttgagacagaggaggcagcagaaagagccatcgagaaaatgaacggg
atgcttctgaatgaccgcaaagtgtttgttggacggtttaagtctcagaaagaacgagaa
gccgagcttggaacggggaccaaggagtttaccaacgtttacatcaagaactttggggac
cgcatggatgacgagaccctgaatggcctctttggcaggtttggacagatcttaagtgtg
aaagtcatgaccgatgaaggtgggaaatcgaaaggattcgggttcgtcagctttgaaagg
catgaagatgcgcagaaagcggtggacgagatgaatggtaaagaactcaatggaaaacac
atttatgttggtcgagcgcagaaaaaagatgaccgtcacacagaacttaaacacaaattt
gaacaggtgacacaagataagagcatcagatatcagggcattaacctttatgtgaaaaat
cttgatgatggcattgatgatgaacggctccagaaagaattttctccatttggaacaatc
accagtacaaaggttatgacagagggtggtcgcagtaaaggattcggttttgtgtgtttc
tcctccccggaagaagccacaaaagctgtttcagaaatgaatgggagaattgtggccacg
aaaccactttatgtagctttagcccagcgcaaagaagaacgtcaggctcacctcactaac
caatatattcaaagaatggcaagtgtacgatctgggccgaaccctgttaacccctaccaa
ccagcatcttccagttactctgtggccgctgtcccacagactcagaactgcgttccatgc
tgccctagccaaattgctcaaccaaggccaagtgctcgctggattgctcagggttcccgg
cctcatccattccccaatgtgcctggtgctatccacccagctgctcctagatcgtcgttg
actactgtaagaccaagctcttcacacgttcaagtcacgacagcacatcgcattactaac
acatcagcacagataacaggtcagcgtcctgccccagcctcttcagctacagcgactcct
gttcactcgattccacagtacaagtatgctgcaggagtccagaactcccagcaacatctt
aatgcccagctggcgcaacagcccgctgtttgcatacagggtcaggaaccttggactgct
tccatgttagtaaccgctcctcaagagccgaagcaaatgctgggtgaaaggctattccct
ctcatccaagccatgcacccgactctggctggtaagatcacgggcatgttgctggacatt
gataactcggaaccacttcgtatgcttgaatctccagtgtctcggtgttctagggctgag
gaagccgtggccacactccaagcccaccaagttaaagaggctgcccagaaagctgttggc
agtacctctggtgtcccaactgtttaa

DBGET integrated database retrieval system