KEGG   Mus musculus (mouse): 18477
Entry
18477             CDS       T01002                                 

Gene name
Prdx1, MSP, MSP23, NkefA, OSF, OSF-3, OSF3, P, PAG, Paga, PrdxI, PrxI, TDX2, TPxA, Tdpx, Tdpx2, pr, prx1
Definition
(RefSeq) peroxiredoxin 1
  KO
K13279  peroxiredoxin 1 [EC:1.11.1.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
mmu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    18477 (Prdx1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    18477 (Prdx1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    18477 (Prdx1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     18477 (Prdx1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   18477 (Prdx1)
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C Endothelin
Other DBs
NCBI-GeneID: 18477
NCBI-ProteinID: NP_035164
MGI: 99523
Ensembl: ENSMUSG00000028691
Vega: OTTMUSG00000009533
UniProt: P35700
Position
4 D1; 4 53.28 cM
AA seq 199 aa
MSSGNAKIGYPAPNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFS
DRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVNKSKEYFSKQK
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtcttcaggaaatgcaaaaattgggtatcctgctcccaacttcaaagctacagctgtt
atgccagatggacaattcaaagatatcagcctaagtgaatacaaaggaaaatatgttgtg
ttcttcttttaccctcttgactttacttttgtgtgtcccacggagatcattgctttcagt
gatagagccgatgaatttaagaaactcaactgccaagtgattggcgcttctgtggattct
cacttctgtcatctggcatggattaacacacccaagaaacaaggaggattgggacccatg
aacattcccttaatatcagatcccaagcgcaccattgctcaggattatggagtcttaaag
gctgatgaaggtatctctttcaggggcctttttattattgatgataaaggtatccttcga
cagataacaataaacgatcttcccgttggccgctctgtggatgagattatacgactagtc
caggccttccagttcactgacaaacatggtgaagtgtgtccagctggctggaaacctggc
agtgataccatcaagcctgatgtcaataagagcaaagagtatttctctaagcagaagtga

DBGET integrated database retrieval system