KEGG   Mus musculus (mouse): 18484Help
Entry
18484             CDS       T01002                                 

Gene name
Pam, PHM
Definition
(RefSeq) peptidylglycine alpha-amidating monooxygenase
  KO
K24006  peptidylglycine monooxygenase / peptidylamidoglycolate lyase [EC:1.14.17.3 4.3.2.5]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    18484 (Pam)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.3  peptidylglycine monooxygenase
     18484 (Pam)
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.5  peptidylamidoglycolate lyase
     18484 (Pam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu2_monoox_C NHL Cu2_monooxygen DUF5128 Motilin_ghrelin
Motif
Other DBs
NCBI-GeneID: 18484
NCBI-ProteinID: NP_038654
MGI: 97475
Ensembl: ENSMUSG00000026335
Vega: OTTMUSG00000034777
UniProt: P97467 F8VQA4 A1L331
Position
1 D; 1 47.76 cM
AA seq 978 aa AA seqDB search
MAGRARSRLLLLLGLLALQSSCLAFRSPLSVFKRFKETTRSFSNECLGTTRPITPIDSSD
FTLDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTG
SYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRD
NHKDCSGVSLHLTRVPQPLIAGMYLMMSVNTVIPPGEKVVNSDISCHYKMYPMHVFAYRV
HTHHLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVEHPVDVAFGDILAARCVFTGEGRT
EATHIGGTSSDEMCNLYIMYYMEAKHAVSFMTCTQNVAPDMFRTIPEEANIPIPVKSDMV
MIHGHHKETENKEKSALIQQPKQGEEEAFEQGDFYSLLSKLLGEREDVVHVHKYNPTEKT
ESGSDLVAEIANVVQKKDLGRSDAREGAEHEEGGNAILVRDRIHKFHRLESTLRPAESRA
LSFQQPGEGPWEPELAGDFHVEEALEWPGVYLLPGQVSGVALDSKNNLVIFHRGDHVWDG
NSFDSKFVYQQRGLGPIEEDTILVIDPNKAEILQSSGKNLFYLPHGLSIDTDGNYWVTDV
ALHQVFKLEPRSKEGPLLVLGRSMQPGSDQNHFCQPTDVAVEPSTGAVFVSDGYCNSRIV
QFSPSGKFITQWGEESSGSSPKPGQFSVPHSLALVPHLNQLCVADRENGRIQCFKTDTKE
FVREIKHASFGRNVFAISYIPGFLFAVNGKPYFGDQEPVQGFVMNFSSGEIIDVFKPVRK
HFDMPHDIVASEDGTVYIGDAHTNTVWKFTLTESRLEVEHRSVKKAGIEVPEIKAEAVVE
PKVKNKPTSSELQKMQEKKKLIKDPGSGVPVVLITTLLVIPVVVLLAIAMFIRWKKSRAF
GDHDRKLESSSGRVLGRLRGKGSSGLNLGNFFASRKGYSRKGFDRVSTEGSDQEKDEDDG
SESEEEYSAPLPTPAPSS
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atggccggacgcgcccgcagccgcctgctgctgctgctggggctgctcgccttgcagagc
agctgcctggccttcagaagcccactttctgtctttaagaggtttaaagaaactaccaga
tcattttccaatgaatgccttggtaccaccagacccatcactcctattgattcttcggat
tttacactggatattcgcatgcctggggtcacacctaaagagtctgacacgtacttctgc
atgtccatgcgtctgcctgtggatgaggaagccttcgtgattgacttcaagcctcgggcc
agcatggacactgtccaccatatgctgctgtttggatgcaacatgccctcatccactggg
agttactggttttgtgatgaaggaacctgtacagataaagccaatattctatatgcctgg
gcaagaaatgctccccccacccggctccctaaaggtgttggattcagagttggaggggaa
actggaagcaaatacttcgtccttcaagttcactatggggacatcagtgcttttcgagat
aatcacaaagactgttccggtgtgtccttacatctcacacgtgtgccacagcctttgatt
gcgggcatgtaccttatgatgtctgtcaacactgttatacccccaggagagaaagtagtg
aattctgacatttcgtgccattacaaaatgtatccaatgcatgtgtttgcctaccgagtc
catactcaccatttaggtaaggtagtgagtggatacagagtaagaaacggacagtggacg
ctgattggacgccagagcccccagctgccacaggctttttacccagtggaacacccagta
gatgttgcttttggtgatatactggcagccagatgtgtgttcactggtgaggggaggacc
gaagccacccacatcggcggcacatctagtgatgaaatgtgcaacttgtacattatgtat
tacatggaagccaagcatgcagtttccttcatgacctgtacacagaatgtggctccagat
atgttcagaactatcccagaagaggccaatattccaattcctgtaaaatccgacatggtt
atgatccatgggcatcacaaagaaacagaaaacaaagaaaagagtgctttaatacagcag
ccaaagcagggagaggaggaagccttcgagcagggtgatttctattcactactttccaag
ctgctaggagaaagggaagatgttgttcatgtgcacaaatataatcctacagaaaagaca
gaatctgggtcagacctggtagctgagattgcaaacgtagtccagaaaaaggaccttggt
cggtctgacgccagagagggagcggagcatgaggaagggggtaatgctatcctggtcaga
gacaggatccacaaattccacaggctagagtcaaccttgaggccagctgagagcagagct
ctatccttccagcagcctggtgaaggtccttgggaaccagaactcgcaggagatttccat
gtggaagaagcactggagtggcctggagtgtacttgttaccaggccaggtttctggggtg
gccctggattctaagaataaccttgtgattttccacagaggtgaccatgtttgggatgga
aactcttttgacagcaagttcgtttaccaacaaagaggtcttggaccaattgaagaagat
accatcctggtcattgacccaaataaagctgaaatactccagtccagcggcaagaatctg
ttttatttaccgcatggtttgagcatagatacagatggaaattattgggtcacggatgtg
gctctccatcaggtgttcaaattggaaccacgtagcaaagaaggccctctcttagttctg
ggaaggagcatgcaacctggcagcgaccaaaatcatttctgccagcccactgatgtggcg
gtggagcccagtactggagctgtcttcgtgtcagatggttactgcaacagtcggatcgtg
cagttctcaccaagcgggaagttcatcactcagtggggagaagagtcttctgggagcagt
cctaagccagggcagttcagtgttcctcacagtttggcccttgtgcctcacctgaaccag
ttgtgtgtggccgatagggaaaatggccggatccagtgtttcaagactgacaccaaagaa
tttgtgagagagattaagcatgcgtcatttggaaggaatgtctttgcaatctcatatata
ccaggtttcctctttgcagtaaatgggaagccttactttggagaccaagaacccgtgcaa
ggatttgtgatgaacttttccagtggggaaattatagatgttttcaaaccagttcgcaag
cactttgacatgcctcatgatattgtggcttctgaagatgggactgtgtacattggcgac
gcacacacaaacaccgtgtggaagttcaccctcactgaaagcaggctggaagtggagcat
cgatcagttaaaaaggctggcattgaggtcccggaaatcaaagccgaggcagttgttgaa
cccaaagtgaagaacaaacccacctcctcagaattgcagaagatgcaggagaaaaagaaa
ctgatcaaagatccaggctcgggagtgcctgtggttctcattacaacccttctggttatc
cctgtggttgtcctgctggccattgccatgtttattcgatggaaaaaatcaagggccttt
ggagatcatgaccgaaagctcgagtcgagttctggaagagtactgggaagactccgagga
aagggaagcagcggcttaaatctaggaaatttctttgcaagccggaaaggctacagcaga
aaagggttcgaccgagtgagcacagaggggagtgaccaagagaaggacgaagatgatgga
agtgagtctgaagaggagtactcggctccgctgcccactcctgcaccttcctcctga

DBGET integrated database retrieval system