KEGG   Mus musculus (mouse): 18488Help
Entry
18488             CDS       T01002                                 

Gene name
Cntn3, Pang
Definition
(RefSeq) contactin 3
  KO
K06761  contactin 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    18488 (Cntn3)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  Contactins
   18488 (Cntn3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set Ig_5 Tissue_fac Pur_ac_phosph_N Interfer-bind fn3_2 DUF4998
Motif
Other DBs
NCBI-GeneID: 18488
NCBI-ProteinID: NP_032805
MGI: 99534
Ensembl: ENSMUSG00000030075
Vega: OTTMUSG00000057269
UniProt: Q07409
Structure
PDB: 

Position
6 D3; 6 47.52 cM
AA seq 1028 aa AA seqDB search
MMLSWKQLILLSFIGCLAGELLLQGPVFIKEPSNSIFPVDSEDKKITLNCEARGNPSPHY
RWQLNGSDIDTSLDHRYKLNGGNLIVINPNRNWDTGSYQCFATNSLGTIVSREAKLQFAY
LENFKTRMRSTVSVREGQGVVLLCGPPPHSGELSYAWVFNEYPSFVEEDSRRFVSQETGH
LYIAKVEPSDVGNYTCVVTSTVTNTRVLGSPTPLVLRSDGVMGEYEPKIEVQFPETLPAA
KGSTVRLECFALGNPVPQINWRRSDGMPFPNKIKLRKFNGMLEIQNFQQEDTGSYECIAE
NSRGKNVARGRLTYYAKPYWLQLLRDVEIAVEDSLYWECRASGKPKPSYRWLKNGDALVL
EERIQIENGALTITNLNVTDSGMFQCIAENKHGLIYSSAELKVVASAPDFSRNPMKKMVQ
VQVGSLVILDCKPRASPRALSFWKKGDMMVREQARVSFLNDGGLKIMNVTKADAGTYTCT
AENQFGKANGTTHLVVTEPTRIILAPSNMDVAVGESVILPCQVQHDPLLDIMFAWYFNGA
LTDFKKDGSHFEKVGGSSSGDLMIRNIQLKHSGKYVCMVQTGVDSVSSAAELIVRGSPGP
PENVKVDEITDTTAQLSWTEGTDSHSPVISYAVQARTPFSVGWQSVRTVPEVIDGKTHTA
TVVELNPWVEYEFRIVASNKIGGGEPSLPSEKVRTEEAAPEIAPSEVSGGGGSRSELVIT
WDPVPEELQNGGGFGYVVAFRPLGVTTWIQTVVTSPDNPRYVFRNESIVPFSPYEVKVGV
YNNKGEGPFSPVTTVFSAEEEPTVAPSHISAHSLSSSEIEVSWNTIPWKLSNGHLLGYEV
RYWNNGGEEESSRKVKVAGNQTSAVLRGLKSNLAYYTAVRAYNSAGAGPFSATVNATTKK
TPPSQPPGNVVWNATDTKVLLNWEQVKAMENESEVTGYKVFYRTSSQNNVHVLNTNKTSA
ELLLPIKEDYIIEVKATTDGGDGTSSEQIRIPRITSMDARGSTSAISNIHPLSGYMSVLL
FFIVNALW
NT seq 3087 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgtcatggaaacagttgatcctgctttcattcattggctgcctggcaggtgaa
cttcttttacaaggccctgtgtttatcaaagagcccagcaacagtattttccctgttgat
tcagaggacaaaaaaataacattaaattgtgaagcaagaggcaacccttcacctcattac
aggtggcagctgaatggcagtgatattgatacaagtctggaccatcgttacaaactgaat
ggaggaaatctcatagttattaaccctaacagaaattgggatacaggaagttaccagtgt
tttgcaacgaattctcttggaacaatagtgagcagagaagccaaactccagtttgcctat
cttgaaaattttaagaccaggatgagaagcactgtgtcggtccgtgaaggccagggagtg
gtgcttctctgtggacccccacctcactcaggagaactgtcatatgcttgggtcttcaat
gagtatccatcatttgttgaagaagacagtcgacgatttgtctctcaagagacaggacac
ctctacatagctaaggtggaaccatctgatgtgggaaattacacatgtgtggtgaccagc
acggtgacaaataccagagtattgggctccccaacccctttggtgctacgctctgatggt
gtcatgggtgaatatgaacccaaaatagaagtccagtttccagagactcttccagcagct
aaaggttcaactgtgaggttggaatgcttcgccctgggaaaccctgttcctcagattaat
tggagaagaagtgatgggatgccgtttcccaacaaaattaagttgaggaagttcaatggt
atgctggaaattcaaaacttccaacaggaagatacaggctcctatgagtgtattgctgaa
aattcacgaggaaaaaatgtggcgagagggcggctcacttactatgcaaaaccttattgg
cttcaactcttaagagatgtggaaattgctgtggaggacagtctttattgggaatgccgg
gcaagtgggaagcctaaaccctcttatcgatggctgaaaaatggagatgccttagtacta
gaggagagaatacagatagaaaatggtgcccttacaataaccaacctcaatgtgactgac
tctggaatgttccaatgtatagcagaaaacaagcatggtctcatctactccagtgctgag
ctcaaggtagtagcttctgctccagatttttcaagaaaccctatgaaaaaaatggtccag
gtgcaggtgggcagcctggtgatcctggattgtaaacccagagcctctccaagggcactt
tctttctggaagaagggagacatgatggtgcgggagcaggcaagggtttcttttttaaat
gatggaggactcaaaatcatgaatgtgactaaggcagacgctggaacctacacctgcaca
gcagaaaaccagtttgggaaagcaaatggcacaacccacttggttgtgacagaacctacg
agaataattttggcaccttcaaacatggacgttgctgttggtgagagcgtcattttaccc
tgccaggttcaacatgatcccctattagacataatgtttgcctggtatttcaatggagcc
cttacagactttaagaaagatggatctcactttgagaaagttggtgggagttcatctggt
gatttaatgatcagaaacattcaattgaaacacagtgggaagtacgtatgtatggtgcag
acaggggtggacagtgtttcctctgcagctgagctcatcgtgagaggttcacctgggcca
ccggaaaatgtgaaggtagatgaaattacagacacaacagcccagctctcttggacggaa
ggcacggacagtcatagcccagttatatcgtatgcagtccaagctaggacgcctttctct
gtgggctggcaaagtgtcagaacagtacctgaggtcattgatggcaagacacatacagct
actgtcgtggagttaaacccatgggtggaatatgaatttcgcattgtagccagtaacaaa
atcggaggtggagaacccagtttaccctcagaaaaagtaaggactgaagaggcagctcca
gaaatcgcaccttctgaggtcagcggaggaggtggaagccgatctgaactagtgataacc
tgggatccagtccctgaagaactacagaatggaggaggttttgggtatgtggttgctttc
cgcccacttggggttaccacctggatccagacagtggtgacatccccagataacccaaga
tacgtctttaggaatgaaagcattgtgcccttttcgccatatgaagttaaagtgggagtt
tacaataacaaaggtgaaggaccctttagcccagtgacaactgtgttctctgcagaggaa
gagcctacagttgccccatctcacatctctgcccatagcctgtcttcctcagaaattgaa
gtttcttggaatacaattccctggaagttgagcaatggacatttactgggctatgaggtg
cggtactggaacaatggaggagaagaagaatcatcccgcaaagtgaaagtggcaggaaat
cagacatcagctgtgctccgaggcctgaagagcaacctggcctattacacagctgtccgg
gcttacaacagcgcaggcgctggtcccttcagcgccacagttaatgcgaccaccaagaaa
acccctcccagtcagccaccaggaaatgttgtttggaatgctacagacactaaagtgcta
cttaattgggaacaagtgaaagccatggagaatgaatcagaagtaacaggctacaaggtt
ttctataggactagcagtcagaataatgtgcacgtgctgaacacaaataaaacttcagct
gaactgttgctgcctatcaaagaagactacattattgaggtcaaggccaccacagatgga
ggggatggcaccagtagtgagcagatcaggattccaagaataaccagtatggatgcaaga
ggatccacgtcagccatttctaacatccaccctttgtcaggttatatgtctgtcctactg
ttctttattgtaaatgctttgtggtga

DBGET integrated database retrieval system