KEGG   Mus musculus (mouse): 18504Help
Entry
18504             CDS       T01002                                 

Gene name
Pax2, Opdc, Pax-2
Definition
(RefSeq) paired box 2
  KO
K15608  paired box protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18504 (Pax2)
   04131 Membrane trafficking [BR:mmu04131]
    18504 (Pax2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    18504 (Pax2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box domain only
    18504 (Pax2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    18504 (Pax2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    18504 (Pax2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAX Pax2_C HTH_32 HTH_23 Homeodomain HTH_28 HTH_Tnp_IS1
Motif
Other DBs
NCBI-GeneID: 18504
NCBI-ProteinID: NP_035167
MGI: 97486
Ensembl: ENSMUSG00000004231
Vega: OTTMUSG00000037630
UniProt: P32114 A0A0R4J267
Position
19 C3; 19 38.09 cM
AA seq 394 aa AA seqDB search
MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV
SHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLA
EGICDNDTVPSVSSINRIIRTKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASND
PVGSYSINGILGIPRSNGEKRKREEDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEA
LDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASANPELGSNVSGTQ
TYPVVTGRDMTSTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEA
WRFSNPALLSSPYYYSAAPRGSAPAAAAAAYDRH
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcactgcaaagcagaccccttctccgcgatgcacccagggcacgggggtgtg
aaccagctcgggggggtgtttgtgaacggccggcccctacccgacgtggtgaggcagcgc
atcgtggagctggcccaccagggtgtgcggccctgtgacatctcccggcagctgcgggtc
agccatggctgtgtcagcaaaatcctgggcaggtactacgagactggcagcatcaagccc
ggagtgattggtggctccaagcccaaggtggcaacgcccaaagtggtggacaagattgcc
gaatacaagcgacagaacccgactatgttcgcctgggagatccgtgacaggctgctagcc
gagggcatctgcgataatgacacagttcccagtgtctcatccatcaacaggatcatccgg
accaaagttcagcagcctttccacccaacgccggatggggcagggacaggagtgactgcc
cccggccacaccatcgttcccagcacggcctcccctcctgtttccagcgcctctaacgac
ccagtgggatcctactccatcaacgggatcctggggattcctcgctccaacggtgagaag
aggaaacgcgaggaagatgtgtctgagggctctgtccctaatggagactcccagagtggt
gtggacagtttgcggaagcacctgcgagccgacaccttcacccagcagcagctggaagct
ctggatcgagtctttgagcgtccttcctatcccgatgtcttccaggcatcagagcacatc
aaatcagaacaggggaatgaatactctctcccagccctgacccctgggcttgatgaagtc
aagtccagtctatctgcatcggccaaccctgagctgggcagcaatgtgtcaggcacacag
acgtaccccgttgtgaccggtcgtgatatgacgagcaccactctacctggttacccccct
catgtgccccccactggccagggaagctaccctacctccaccctggcaggaatggtgcct
gggagcgagttctcaggcaacccatacagccatccccagtacaccgcctacaatgaggct
tggagattcagcaaccccgccttactaagttccccttattattatagtgccgccccccgg
ggctccgcccctgccgctgctgccgctgcctatgaccgccactag

DBGET integrated database retrieval system