KEGG   Mus musculus (mouse): 18509Help
Entry
18509             CDS       T01002                                 

Gene name
Pax7, Pax-7
Definition
(RefSeq) paired box 7
  KO
K09381  paired box protein 3/7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    18509 (Pax7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18509 (Pax7)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box plus homeo domain
    18509 (Pax7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAX Homeodomain Pax7 Homeobox_KN HTH_32 HTH_23 HTH_Tnp_IS1
Motif
Other DBs
NCBI-GeneID: 18509
NCBI-ProteinID: NP_035169
MGI: 97491
Ensembl: ENSMUSG00000028736
Vega: OTTMUSG00000010060
UniProt: P47239
Position
4 D3; 4 70.83 cM
AA seq 503 aa AA seqDB search
MAALPGAVPRMMRPGPGQNYPRTGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIV
EMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPRQVATPDVEKKIEE
YKRENPGMFSWEIRDRLLKDGHCDRSTVPSVSSISRVLRIKFGKKEDDEEGDKKEEDGEK
KAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYP
DIYTREELAQRTKLTEARVQVWFSNRRARWRKQAGANQLAAFNHLLPGGFPPTGMPTLPP
YQLPDSTYPTTTISQDGGSTVHRPQPLPPSTMHQGGLAAAAAAADTSSAYGARHSFSSYS
DSFMNPGAPSNHMNPVSNGLSPQVMSILSNPSAVPPQPQADFSISPLHGGLDSASSISAS
CSQRADSIKPGDSLPTSQSYCPPTYSTTGYSVDPVAGYQYSQYGQTAVDYLAKNVSLSTQ
RRMKLGEHSAVLGLLPVETGQAY
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgcccggcgcggtccccaggatgatgagacccggcccggggcagaactac
ccgcgcaccggcttccccctggaagtgtccacccctcttggccaaggccgggtcaatcag
cttggtggggtcttcatcaacggtcgacccctgccgaaccacatccgtcacaagatagtg
gaaatggcccaccatggcatccggccctgcgtcatctcccgtcagctccgtgtttcccat
ggttgtgtctccaagattctgtgccgatatcaggagactgggtccatccggcccggggct
atcggaggcagcaagcccagacaggtggcgactccggatgtggagaaaaagattgaggag
tataagagagagaaccccgggatgttcagctgggaaatccgggaccggctgctgaaggac
ggtcactgcgaccgaagcacggtgccctcagtgagttcgattagccgagtgctcagaatc
aagttcgggaagaaagaggacgacgaggaaggagacaagaaagaagaagatggcgagaag
aaagccaaacacagcatcgatggcatcctgggcgacaaagggaaccgtctggatgagggc
tcagatgtggaatcagaacccgacctccccctgaagcgcaagcagcgccgcagtcggacc
acgttcacagccgagcagctggaggagctggagaaggccttcgagaggacccactacccg
gacatctacacccgggaggagctggcacagaggaccaagctcacggaggcacgcgtccag
gtctggttcagtaaccggcgtgcccgctggcgtaagcaggcaggagctaaccagctggcc
gccttcaaccaccttctgccgggaggtttcccacccaccggcatgcccacgctgccaccc
taccagctgccggactctacctaccccaccaccaccatctcccaagatggaggcagcaca
gtacacaggccccagccccttccgccatcaaccatgcatcagggtgggctggctgcggcc
gctgcagcagcggacaccagctctgcctacggagcccgccacagcttctccagctactct
gacagcttcatgaaccctggggctccctccaaccacatgaaccctgtcagcaatggcctg
tctcctcaggtcatgagcatccttagcaacccgagtgccgtgcctccacagccccaggcc
gacttctccatctccccgctgcatggaggcctggactcggcttcctccatctcagccagc
tgcagccaacgggccgactccatcaagccaggagacagcttgcccacgtcccagtcttac
tgcccacccacctacagcaccactggctacagtgtggaccctgtggctggctaccagtac
agccagtatggccaaactgctgttgattacctggccaaaaacgtgagcctgtccacacag
cgccgtatgaagcttggggaacactccgctgtgctgggacttcttcctgtggaaacggga
caagcctactag

DBGET integrated database retrieval system