KEGG   Mus musculus (mouse): 18514Help
Entry
18514             CDS       T01002                                 

Gene name
Pbx1, 2310056B04Rik, D230003C07Rik, Pbx-1
Definition
(RefSeq) pre B cell leukemia homeobox 1
  KO
K09355  pre-B-cell leukemia transcription factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04927  Cortisol synthesis and secretion
mmu04934  Cushing syndrome
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    18514 (Pbx1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    18514 (Pbx1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    18514 (Pbx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18514 (Pbx1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, PBC
    18514 (Pbx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PBC Homeodomain Homeobox_KN YdaS_antitoxin HTH_3 Sec15
Motif
Other DBs
NCBI-GeneID: 18514
NCBI-ProteinID: NP_899198
MGI: 97495
Ensembl: ENSMUSG00000052534
Vega: OTTMUSG00000040100
UniProt: P41778
Structure
PDB: 

Position
1 H2.3; 1 75.95 cM
AA seq 430 aa AA seqDB search
MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDE
AQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGP
EKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVM
NLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNF
NKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQE
EANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQG
AQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEG
PGSVHSDTSN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcagccgaggctgatgcattcccacgctggggtcgggatggccggacacccc
ggcctgtcccagcacttgcaggatggggccggagggaccgagggggagggcgggaggaag
caggacatcggggacattttacagcaaattatgaccatcacagaccagagtttggatgaa
gcgcaggccagaaaacatgctttaaactgccacagaatgaagcctgccttgtttaatgtg
ttgtgtgaaatcaaagaaaaaacagttttgagtattcggggagcccaagaagaggagccc
acagacccccagctcatgcgactggacaacatgctgctagcagaaggggtggcggggcct
gagaagggcggaggctcggcagcggcggcggcggcagcggcagcttctgggggtgcaggt
tcagacaactcagtggagcattccgactacagagccaaactctcacagatcagacaaatc
taccacacagagctggagaagtatgagcaggcatgcaatgaattcaccacccacgtgatg
aacctccttcgagagcaaagccggaccaggcccatctctccgaaggagatcgagcggatg
gtgagcatcatccaccgcaagttcagctccatccagatgcagctgaaacagagcacgtgc
gaggccgtcatgatcctgcgctcccggttcctggatgcgaggcggaagagacggaatttc
aacaagcaagccacagaaattctgaatgaatatttctattcccatctcagcaacccttac
cccagtgaggaagccaaagaggagttagccaagaagtgcggcatcacagtctcccaggta
tcaaactggtttggaaataagcgaatccggtacaagaagaacataggtaaatttcaagag
gaagccaatatttatgctgccaaaacggctgtcacagccaccaatgtgtcagcccatgga
agccaagctaactcgccctctactcccaactcagcgggttcttccagttcttttaacatg
tcaaactctggagatttgttcatgagcgtgcagtcactcaatggggattcttaccaaggg
gcccaggttggagccaacgtgcaatcacaggtggatacccttcgccatgttatcagccag
acaggaggatacagtgacggactcgcagccagtcagatgtacagtccgcagggcatcagt
gctaatggaggttggcaggatgctactaccccttcatcagtgacctcccctacagaaggc
cctggcagtgttcactctgatacctccaactga

DBGET integrated database retrieval system