KEGG   Mus musculus (mouse): 18534
Entry
18534             CDS       T01002                                 

Gene name
Pck1, AI265463, PEP, PEPCK, PEPCK-C, Pck-, Pck-1
Definition
(RefSeq) phosphoenolpyruvate carboxykinase 1, cytosolic
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00020  Citrate cycle (TCA cycle)
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
mmu03320  PPAR signaling pathway
mmu04068  FoxO signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04964  Proximal tubule bicarbonate reclamation
Module
mmu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18534 (Pck1)
   00020 Citrate cycle (TCA cycle)
    18534 (Pck1)
   00620 Pyruvate metabolism
    18534 (Pck1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    18534 (Pck1)
   04151 PI3K-Akt signaling pathway
    18534 (Pck1)
   04152 AMPK signaling pathway
    18534 (Pck1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    18534 (Pck1)
   04922 Glucagon signaling pathway
    18534 (Pck1)
   04920 Adipocytokine signaling pathway
    18534 (Pck1)
   03320 PPAR signaling pathway
    18534 (Pck1)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    18534 (Pck1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    18534 (Pck1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     18534 (Pck1)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 18534
NCBI-ProteinID: NP_035174
MGI: 97501
Ensembl: ENSMUSG00000027513
Vega: OTTMUSG00000016689
UniProt: Q9Z2V4
Position
2 H3; 2 95.79 cM
AA seq 622 aa
MPPQLHNGLDFSAKVIQGSLDSLPQAVRKFVEGNAQLCQPEYIHICDGSEEEYGQLLAHM
QEEGVIRKLKKYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPKTGLSQLGRWMSEE
DFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMGISV
LEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSL
LGKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPSL
PGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNV
AETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDAEPCAHPNSRFCTPASQCPIIDPAW
ESPEGVPIEGIIFGGRRPEGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPF
AMRPFFGYNFGKYLAHWLSMAHRPAAKLPKIFHVNWFRKDKDGKFLWPGFGENSRVLEWM
FGRIEGEDSAKLTPIGYIPKENALNLKGLGGVNVEELFGISKEFWEKEVEEIDRYLEDQV
NTDLPYEIERELRALKQRISQM
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgcctcctcagctgcataacggtctggacttctctgccaaggtcatccagggcagcctc
gacagcctgccccaggcagtgaggaagttcgtggaaggcaatgctcagctgtgccagccg
gagtatatccacatctgcgatggctccgaggaggagtacgggcagttgctggcccacatg
caggaggagggtgtcatccgcaagctgaagaaatatgacaactgttggctggctctcact
gaccctcgagatgtggccaggatcgaaagcaagacagtcatcatcacccaagagcagaga
gacacagtgcccatccccaaaactggcctcagccagctgggccgctggatgtcggaagag
gactttgagaaagcattcaacgccaggttcccagggtgcatgaaaggccgcaccatgtat
gtcatcccattcagcatggggccactgggctcgccgctggccaagattggtattgaactg
acagactcgccctatgtggtggccagcatgcggatcatgactcggatgggcatatctgtg
ctggaggccctgggagatggggagttcatcaagtgcctgcactctgtggggtgccctctc
cccttaaaaaagcctttggtcaacaactgggcctgcaaccctgagctgaccctgatcgcc
cacctcccggaccgcagagagatcatctcctttggaagcggatatggtgggaactcacta
ctcgggaagaaatgctttgcgttgcggatcgccagccgtctggctaaggaggaagggtgg
ctggcggagcatatgctgatcctgggcataactaaccccgaaggcaagaagaaatacctg
gccgcagccttccctagtgcctgtgggaagactaacttggccatgatgaaccccagcctg
cccgggtggaaggtcgaatgtgtgggcgatgacattgcctggatgaagtttgatgcccaa
ggcaacttaagggctatcaacccagaaaacgggttttttggagttgctcctggcacctca
gtgaagacaaatccaaatgccattaaaaccatccagaaaaacaccatcttcaccaacgtg
gccgagactagcgatgggggtgtttactgggaaggcatcgatgagccgctggccccggga
gtcaccatcacctcctggaagaacaaggagtggagaccgcaggacgcggaaccatgtgcc
catcccaactcgagattctgcacccctgccagccagtgccccattattgaccctgcctgg
gaatctccagaaggagtacccattgagggtatcatctttggtggccgtagacctgaaggt
gtcccccttgtctatgaagccctcagctggcagcatggggtgtttgtaggagcagccatg
agatctgaggccacagctgctgcagaacacaagggcaagatcatcatgcacgaccccttt
gccatgcgacccttcttcggctacaacttcggcaaatacctggcccactggctgagcatg
gcccaccgcccagcagccaagttgcccaagatcttccatgtcaactggttccggaaggac
aaagatggcaagttcctctggccaggctttggcgagaactcccgggtgctggagtggatg
ttcgggcggattgaaggggaagacagcgccaagctcacgcccatcggctacatccctaag
gaaaacgccttgaacctgaaaggcctggggggcgtcaacgtggaggagctgtttgggatc
tctaaggagttctgggagaaggaggtggaggagatcgacaggtatctggaggaccaggtc
aacaccgacctcccttacgaaattgagagggagctccgagccctgaaacagagaatcagc
cagatgtaa

KEGG   Mus musculus (mouse): 74551
Entry
74551             CDS       T01002                                 

Gene name
Pck2, 1810010O14Rik, 9130022B02Rik, PEPCK-M
Definition
(RefSeq) phosphoenolpyruvate carboxykinase 2 (mitochondrial)
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00020  Citrate cycle (TCA cycle)
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
mmu03320  PPAR signaling pathway
mmu04068  FoxO signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04964  Proximal tubule bicarbonate reclamation
Module
mmu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    74551 (Pck2)
   00020 Citrate cycle (TCA cycle)
    74551 (Pck2)
   00620 Pyruvate metabolism
    74551 (Pck2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    74551 (Pck2)
   04151 PI3K-Akt signaling pathway
    74551 (Pck2)
   04152 AMPK signaling pathway
    74551 (Pck2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    74551 (Pck2)
   04922 Glucagon signaling pathway
    74551 (Pck2)
   04920 Adipocytokine signaling pathway
    74551 (Pck2)
   03320 PPAR signaling pathway
    74551 (Pck2)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    74551 (Pck2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    74551 (Pck2)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     74551 (Pck2)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 74551
NCBI-ProteinID: NP_083270
MGI: 1860456
Ensembl: ENSMUSG00000040618
UniProt: Q8BH04 A0A0R4J0G0
Position
14 C3; 14 28.19 cM
AA seq 640 aa
MAAMYLPGLRLSRHGLRPWCWSPCRSIQTLHVLSGDMSQLPAGVRDFVARSAHLCQPEGI
HICDGTEAENTAILALLEEQGLIRKLPKYKNCWLARTDPKDVARVESKTVIVTPSQRDTV
PLLAGGARGQLGNWMSPDEFQRAVDERFPGCMQGRIMYVLPFSMGPVGSPLSRIGVQLTD
SAYVVASMRIMTRLGTPVLQALGDGDFIKCLHSVGQPLTGHGDPVGQWPCNPEKTLIGHV
PDQREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPAGKKRYVAA
AFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGQLRAINPENGFFGVAPGTSAA
TNPNAMATIQSNTLFTNVAETSDGGVYWEGIDQPLPPGVTITSWLGKPWKPGDKEPCAHP
NSRFCVPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRS
ESTAAAEHKGKTIMHDPFAMRPFFGYNFGRYLEHWLSMEGQKGARLPRIFHVNWFRRDEA
GRFLWPGFGENARVLDWICRRLEGEDSAQETPIGLVPKEGALDLSGLSAVDTSQLFSIPK
DFWEQEVRDIRGYLTEQVNQDLPKEVLAELEALEGRVQKM
NT seq 1923 nt   +upstreamnt  +downstreamnt
atggctgctatgtacctccccggcctgcggcttagccggcacgggctaaggccctggtgc
tggtcaccgtgccgtagcatccaaaccctgcatgtgctcagtggagatatgagtcagctg
ccggctggagttcgagactttgtggcgcgcagtgcgcatctgtgccaaccagagggcatc
cacatctgtgatgggaccgaggctgagaacactgccatactggccctgctggaagaacag
ggtcttatccgcaaactccccaagtataagaactgctggctggcccgcacagaccccaag
gatgtggcacgggtagaaagcaagacggtgattgtaactccttcgcagcgggacacagtg
cctctcctggctggtggggccagggggcagctgggcaactggatgtccccagatgagttc
cagagagctgtggacgagagattcccaggatgcatgcagggccgcattatgtatgtgctt
ccattcagcatgggtcccgtgggctccccactctcccgcattggagtgcagctcactgac
tcggcttacgtggtggccagtatgcgtattatgacccgcctggggacacctgtacttcag
gccctgggagatggtgacttcatcaagtgtctgcattcagtgggccagcccctgactgga
catggggatcctgtgggccagtggccgtgcaatccagaaaaaaccctgattggccacgtg
ccagaccagcgggagatcgtctccttcggcagcggctatggtggtaactccttgctgggc
aagaagtgctttgccctgcgcatcgcctctcgcctggccagggatgagggctggctggca
gagcacatgctgattttgggcatcaccaaccctgcagggaaaaagcgctacgtggcagct
gctttccccagtgcctgtggcaagaccaatctggccatgatgaggcctgcattgccgggc
tggaaagtggagtgtgtgggggatgacatcgcctggatgaggtttgacagtgaaggtcaa
ctccgggccatcaaccctgagaatggcttctttggggtggcccctggtacctctgctgcc
accaatcccaatgccatggccacaattcagagtaatactctcttcaccaacgtggctgag
accagtgatggcggtgtgtactgggaaggcattgaccagcctcttccgcctggtgtcacc
ataacctcgtggctgggaaagccctggaaacctggtgacaaggaaccctgtgcacatcca
aactcgcgcttttgtgtcccggctcgccagtgccccatcatggacccagcctgggaagca
ccagaaggtgtccctattgatgccatcatctttggaggccgccgacccaaaggggtacca
ctggtgtacgaggccttcaactggcgtcatggggtgtttgtaggtagcgccatgcgctct
gagtccactgccgctgcggagcacaaaggaaagaccattatgcatgatccctttgccatg
cggcctttttttggctataactttggacgctacctggaacactggttgagcatggaggga
caaaaaggtgcccggctgcctcgtatcttccatgtcaattggttccggagagatgaagca
ggccgcttcctgtggccaggctttggagagaatgctcgtgtgctagactggatctgccga
agattagaaggagaagacagtgcccaagagactcccattgggctagtaccaaaggaagga
gccctggacctcagtggcctcagcgcagtggacaccagtcagctgttctccatccccaag
gacttctgggagcaggaggttcgtgatattcggggctacctgacagagcaagtcaaccag
gacctgcccaaggaggtgttggctgagctcgaggccctggaaggacgtgtacaaaaaatg
tga

DBGET integrated database retrieval system