KEGG   Mus musculus (mouse): 18536
Entry
18536             CDS       T01002                                 

Gene name
Pcm1, 2600002H09Rik, 9430077F19Rik, C030044G17Rik
Definition
(RefSeq) pericentriolar material 1
  KO
K16537  pericentriolar material 1 protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    18536 (Pcm1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     18536 (Pcm1)
SSDB
Motif
Pfam: PCM1_C
Other DBs
NCBI-GeneID: 18536
NCBI-ProteinID: NP_076151
MGI: 1277958
Ensembl: ENSMUSG00000031592
Vega: OTTMUSG00000031635
UniProt: Q9R0L6
Position
8 A4; 8 23.89 cM
AA seq 2025 aa
MATGGGPFEEVMHDQDLPNWSNDSVDDRLNNMEWGGQQKKANRSSEKNKKKFGVASDKRV
TNAISPESSPGVGRRRTKIPHTFPHSRYMTQMSVPEQAELEKLKQRINFSDLDQRSIGSD
SQGRATAANNKRQLSENRKPFNFLPMQINTNKSKDATASLPKREMTTSAQCKELFASALS
NDLLQNCQVSEEDGRGEPAMESSQIVSRLVQIRDYITKASSMREDLVEKNERSANVERLT
HLIEHLKEQEKSYMKFLQKILARDPQQEPMEETENLKKQHDLLKRMLQQQEQLRALQGRQ
AALLALQHKAEQAIAVMDDSVVTETTGSLSGVSITSELNEELNDLIQRFHNQLRDSQPPA
VPDNRRQAESLSLTREISQSRNPSVSEHLPDEKVQLFSKMRVLQEKKQKMDKLLGELHNL
RDQHLNNSSFVPSTSLQRSGDKRSSTVALSAPVGFASAVNGEANSLISSVPCPATSLVSQ
NESENEGHLNPAEKLQKLNEVQKRLNELRELVHYYEQTSDMMTDAVNENTKDEETEESEY
DSEHENSEPVTNIRNPQVASTWNEVNTNSNTQCGSNNRDGRPVNSNCEINNRSAANIRAL
NMPPLDCRYNREGEQRLHVAHGEDEEEEVEEEGVSGASLSSRRSSLVDEAPEDEEFEQKI
SRLMAAKEKLKQLQDLVAMVQDDDATQVVVPAASNLDDFYAAEEDIKQNSNNARENSNKI
DTGVNEKTREKFYEAKLQQQQRELKQLQEERKKLIEIQEKIQAVQKACPDLQLSATSISS
GPTKKYLPAITSTPTVNENDSSTSKCVIDPEDSSVVDNELWSDMRRHEMLREELRQRRKQ
LEALMAEHQRRQGLAETSSPVAISLRSDGSENLCTPQQSRTEKTMATWGGSTQCALDEEG
DEDGYLSEGIVRTDEEEEEEQDASSNDNFPIYPPSMNQNSYNVKETKTRWKSNRPVSADG
NYRPLAKTRQQNISMQRQENLRWVSELSYIEEKEQWQEQINQLKKQLDFSVNICQTLMQD
QQTLSCLLQTLLTGPYSVLPSNVASPQVHLIMHQLNQCYTQLTWQQNNVQRLKQMLTELM
RQQNQHPEKPRSKERGSSASHPSSPNLFCPFSFPTQPVNLFNLPGFTNFPSFAPGMNFSP
LFPSNFGDFSQNVSTPTEQQQPLAQNPSGKTEYMAFPKPFESSSSLGAEKQRNQKQPEEE
AENTKTPWLYDQEGGVEKPFFKTGFTESVEKATNSNRKNQPDTSRRRRQFDEESLESFSS
MPDPIDPTTVTKTFKTRKASAQASLASKDKTPKSKSKKRNSTQLKSRVKNIGYESASVSS
TCEPCKNRNRHSAQTEEPVQAKLFSRKNHEQLEKIIKYSRSAEISSETGSDFSMFEALRD
TIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESDEREGE
NVKPVNSGTWVASNSELTPSESLVTTDDETFEKNFERETHKVSEQNDADNVSVMSVSSNF
EPFATDDLGNTVIHLDQALARMREYERMKTETESHSNMRCTCRVIEDEDGAAAAATVSNS
EETPIIENHNSPQPISDVSAVPCPRIDTQQLDRQIKAIMKEVIPFLKEHMDEVCSSQLLT
SVRRMVLTLTQQNDESKEFVKFFHKQLGSILQDSLAKFAGRKLKDCGEDLLVEISEVLFN
ELAFFKLMQDLDNNSIAVKQRCKRKIEAAGVRQSYAKEAKRILEGDHGSPAGEIDDEDKD
KDETETVKQTQTSEVYDAKGPKNVRSDVSDQEEDEESERCPVSINLSKAESQALTNYGSG
EDENEDEEMEDFEESPVDIQTSLQANTETTEENEHDSQILQHDLEKTPESTNVPSDQEPT
SKNDQDSSPVKPCYLNILENEQQLNSATHKDSLTTTDSSKQPEPLPLPLAASETLVPRVK
EVKSAQETPESSLAGSPDTESPVLVNDYEAESGNISQKSDEEDFVKVEDLPLKLTVYSEE
ELRKKMIEEEQKNHLSGEICEMQTEELAGNSQILKEPETVGAQSI
NT seq 6078 nt   +upstreamnt  +downstreamnt
atggccacaggaggaggtccttttgaagaagtcatgcatgatcaggacttaccaaactgg
agcaatgacagtgtggatgaccgactcaacaatatggagtggggtggccaacagaagaag
gccaatagatcatcagaaaagaataagaaaaagtttggtgtagcaagtgataagagggta
actaacgctatttctccggagtcatcgccaggagttggaaggcgaagaacaaagattcca
catacgtttccacacagcagatatatgactcagatgtctgttccagagcaggcagaacta
gagaaacttaaacagcggataaacttcagtgatttagatcagagaagtattggaagtgat
tctcaaggtagagcaacagcggctaacaacaaacgtcagcttagtgaaaaccgaaagccc
ttcaactttttgcctatgcagattaatactaacaagagcaaggatgctactgcaagtctt
ccaaagagagagatgacaacgtcagcacagtgcaaagagttgtttgcttctgctctaagt
aatgaccttttgcaaaactgtcaagtctctgaagaagatgggagaggggagcctgcaatg
gagagcagccagattgtaagcaggcttgttcaaatccgtgactatattactaaagctagt
tctatgcgagaagatcttgtagagaaaaatgaaagatctgccaatgttgagcgtcttact
catctaatagagcatcttaaagagcaagaaaagtcatatatgaaatttctccagaaaatc
cttgccagagatcctcagcaggagcctatggaagagacagaaaatttgaagaaacaacat
gatttattaaaaagaatgttacaacagcaggagcagctgcgagctctgcagggccgacag
gctgctcttctagctttgcagcataaagcagagcaagctatagctgtgatggatgactct
gttgttacagaaactacaggaagcttatctggagtcagcatcacatctgaactaaatgaa
gaactgaatgatttaattcagcgtttccataatcagcttcgtgattctcagcctccagct
gttccagacaacagaagacaggcagaaagtctttcattaactagagagatttctcagagc
agaaatccctcagtttctgaacatttacctgatgagaaagtacagctttttagcaaaatg
agagtactacaggaaaagaaacagaaaatggacaaattacttggagaacttcataacctt
cgagatcagcatctgaacaactcatcatttgtgccttcaacttctctccaaagaagtggg
gataagagaagttcaactgtagctctctctgctcctgtgggctttgcatcagctgtcaat
ggagaggccaatagtcttatctcatctgttccctgtcctgccacctctctagtttctcag
aatgagagtgaaaatgaaggtcatctaaatccagctgaaaaactacagaagttaaatgaa
gttcaaaagagattgaatgaactgagagaattagttcattattatgaacaaacatcagat
atgatgacagatgctgtaaatgaaaatacaaaagatgaagaaactgaagagtcagaatat
gattctgaacatgaaaattctgaacctgttactaacattagaaatccacaggtagcttct
acctggaatgaagtgaatactaacagtaatacacagtgtggttctaacaatagagatggg
agaccagttaattctaactgtgaaattaataacagatctgctgccaacatcagagctcta
aacatgcctccattagactgtcgatacaatagagaaggagagcagaggttgcatgtagca
catggagaagatgaggaagaagaagtagaagaggaaggagtcagtggggcttcattatct
agtcgtaggagcagtctggtcgatgaagcaccagaagatgaagaatttgaacagaagatt
agtagactcatggctgcaaaagagaaacttaaacagctccaagatcttgttgctatggtg
caggatgatgatgcaactcaagtggttgtccctgctgcatcaaatttggatgatttctat
gcagcagaagaagatatcaaacaaaattccaataatgcaagagaaaattctaataaaata
gatactggagtaaatgaaaaaacaagagagaaattttatgaggctaaactacagcagcaa
cagagagagcttaaacaattgcaggaggaaagaaagaaattgattgaaattcaagagaaa
attcaagcagtgcaaaaggcatgccctgaccttcagctctcagccactagtataagtagt
ggtcccacaaaaaaatatctaccagctattacttcaactccaactgttaatgaaaatgac
agcagtacaagcaagtgtgttattgatcctgaagattcttcagtggtggataatgagttg
tggtcagacatgagaagacatgaaatgttaagggaagagctacggcagagaaggaagcaa
cttgaagctctaatggctgaacaccagaggaggcaaggtctagctgagacctcatctcca
gtggctatatcattgagaagtgatggatctgagaacctgtgcactcctcagcaaagtaga
acagaaaaaacaatggcaacttggggaggttctactcagtgtgcattagatgaagaagga
gatgaggatggctatctttcagaaggaattgttcgcacagatgaagaagaggaggaggag
caggatgccagttccaatgataacttccctatataccctcctagcatgaatcaaaattct
tacaatgtaaaggaaaccaaaaccaggtggaagagcaatcgccctgtttcagcagatgga
aattaccgtcctttagccaagacaaggcagcagaatatcagcatgcaacgacaagaaaac
cttcgatgggtgtcagagctctcttacatagaagagaaggagcagtggcaagaacagatt
aatcagctaaagaaacaactcgatttcagtgtcaatatttgtcagactctgatgcaagac
caacagactttatcttgtttgctgcagactcttctaacaggtccgtacagtgttctgcct
agtaatgtggcgtcccctcaagtgcaccttatcatgcatcagctgaaccaatgctacaca
cagctaacatggcagcagaacaatgtccagaggttaaaacaaatgctaactgaacttatg
cgccaacaaaatcagcacccagaaaagcctagaagcaaagaaagaggcagtagtgcgtca
cacccttcttctcccaatttattttgccctttcagctttccaacacagcctgtaaatctg
tttaacctgcctggatttactaactttccatcatttgcaccaggaatgaatttcagccct
ttatttccttctaattttggagatttttctcagaatgtttctacacctactgaacagcag
cagccattagctcaaaatccttcagggaaaacagagtatatggcttttccaaaacccttt
gaaagcagttcttctcttggagcagaaaagcaaaggaatcagaaacagcccgaagaggaa
gctgaaaacactaagacaccatggttatatgatcaagaaggtggagtagaaaaaccattt
ttcaagactggatttacagagtctgtagagaaagctacaaatagtaaccgcaaaaatcaa
ccagatacaagcaggagaagacgtcagtttgatgaagaatccttggaaagctttagcagt
atgcctgatcctatagacccaacaacagtaactaaaacatttaaaacaagaaaagcatct
gcccaggccagcctggcctctaaggacaaaactcccaaatcaaagagtaagaagaggaat
tctactcagctgaaaagtagagttaaaaatattgggtatgaaagtgccagtgtgtctagc
acatgtgaaccttgcaaaaataggaacagacattcagcccagactgaagagcctgttcaa
gcaaaattattcagcagaaagaatcatgaacagctggaaaaaataataaaatatagtagg
tctgcagaaatatcttcagagactggaagtgatttttccatgtttgaagctttacgggat
actatttattccgaagtggctacattaatttctcaaaatgagtctcgtccacattttctt
attgaacttttccatgagctgcagctacttaatacagactacttgagacagagagcttta
tatgcattgcaggatatcgtatccagacacatttctgaaagtgatgaaagagaaggagaa
aatgtaaagcctgtgaactctggcacttgggtagcatccaattcagagcttactccgagt
gagagccttgttactactgacgatgaaacatttgagaagaactttgaaagagaaacacat
aaagtaagtgaacagaatgatgctgacaacgtgagtgtcatgtccgtatcctccaacttt
gagccatttgcaacagacgacttaggtaacactgtgattcacttggatcaagcattagcc
agaatgagagagtatgagcgcatgaagaccgagacagaaagtcactcaaatatgagatgc
acttgcagggttattgaggatgaagatggtgctgccgccgctgccacagtcagtaattca
gaagaaactcccattattgagaatcacaattcaccacaacctataagtgatgtttctgcc
gtcccctgtcctagaattgatactcagcaactggaccgccaaattaaagcaattatgaaa
gaagtcattccttttttgaaggagcacatggatgaagtgtgttcgtctcagcttctcact
tcagtaagacgtatggtcttgacccttacccagcagaatgatgagagcaaagagtttgtg
aagttctttcataaacaactaggaagtatattgcaggattcactagcaaaatttgcaggc
agaaagctgaaagactgtggagaagatcttcttgtggagatctctgaagtgttgtttaat
gaattggctttctttaagctcatgcaagacttggataataatagcatagctgttaaacag
aggtgcaagaggaaaattgaagcagctggagtgaggcagtcttatgcaaaagaggccaaa
aggattcttgaaggagatcatggctcacctgctggagagattgatgatgaagacaaagac
aaggatgagactgaaactgttaagcagactcagacttctgaggtatatgatgctaaaggt
cccaaaaatgtaagatctgatgtttctgatcaagaagaagatgaagaaagtgaacggtgt
ccagtgtctattaatctgtctaaagctgaaagtcaggctttaactaattatggaagtgga
gaagatgagaatgaggatgaagaaatggaagactttgaagagagtcctgtggacatccag
acttcacttcaggctaacactgaaactacagaagaaaatgaacatgacagtcagattctg
caacatgatcttgaaaaaacaccagaaagtacaaatgtaccatcagaccaagaaccaact
agtaagaatgatcaagacagctctcctgtgaaaccttgttatctcaatatcttggaaaat
gagcaacagttaaatagtgctacccataaggactcgcttactactactgattcatctaaa
cagcctgagcctctgccattacccttggctgcaagtgaaaccttagtgcctagagtcaaa
gaagtgaagtctgctcaggaaacgcctgagagctctctggctggaagccctgatactgaa
tctccagtgttagtgaatgactatgaagcagagtctggtaacataagtcaaaagtcggat
gaagaagactttgtgaaagttgaggatttgccgctcaaactgacagtctattcagaggaa
gagctaaggaagaaaatgatagaagaagaacagaaaaaccatttatctggtgaaatatgt
gaaatgcagacagaagaattagctggaaattctcagatactgaaagaacctgaaacagtg
ggagcccagagtatatga

DBGET integrated database retrieval system