KEGG   Mus musculus (mouse): 18538
Entry
18538             CDS       T01002                                 

Gene name
Pcna
Definition
(RefSeq) proliferating cell nuclear antigen
  KO
K04802  proliferating cell nuclear antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
mmu04110  Cell cycle
mmu04530  Tight junction
mmu05161  Hepatitis B
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18538 (Pcna)
   03410 Base excision repair
    18538 (Pcna)
   03420 Nucleotide excision repair
    18538 (Pcna)
   03430 Mismatch repair
    18538 (Pcna)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    18538 (Pcna)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    18538 (Pcna)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    18538 (Pcna)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    18538 (Pcna)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18538 (Pcna)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    18538 (Pcna)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     18538 (Pcna)
   MMR (mismatch excision repair)
    Other MMR factors
     18538 (Pcna)
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    18538 (Pcna)
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad1 Rad9 Hus1
Other DBs
NCBI-GeneID: 18538
NCBI-ProteinID: NP_035175
MGI: 97503
Ensembl: ENSMUSG00000027342
Vega: OTTMUSG00000015547
UniProt: P17918 Q542J9
Position
2 F2; 2 64.15 cM
AA seq 261 aa
MFEARLIQGSILKKVLEALKDLINEACWDVSSGGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVIKMPSGEFARICRDLSHIGDAVVISCAKNGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVHLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEAS
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtttgaggcacgcctgatccagggctccatcctgaagaaggtgctggaggctctcaaa
gacctcatcaatgaggcctgctgggacgtcagctcgggcggcgtgaacctgcagagcatg
gactcgtctcacgtctccttggtacagcttactctgcgctccgaaggcttcgacacatac
cgctgcgaccgcaacctagccatgggcgtgaacctcaccagcatgtccaaaattctaaaa
tgtgctggtaatgaagacatcattacattaagggctgaagataatgcagacaccttagca
ctagtattcgaagcaccaaatcaagagaaagtttcagactatgaaatgaagttaatggac
ttagatgtggagcaacttggaatcccagaacaggagtacagctgtgtaataaagatgccg
tcgggtgaatttgcacgtatatgccgagaccttagccacattggagatgctgttgtgata
tcctgtgcaaagaatggggtgaagttttctgcaagtggagagcttggcaatgggaacatt
aagttgtcacaaacaagtaatgtggataaagaagaggaggcggtaaccatagagatgaat
gagcctgttcacctaacgtttgctctgaggtacctgaactttttcacaaaagccactcca
ctgtctcctacagtaacactcagtatgtctgcagatgtgccccttgttgtagagtataaa
attgctgacatgggacacttaaagtattatttggctcccaagattgaagatgaggaagca
tcttag

DBGET integrated database retrieval system