KEGG   Mus musculus (mouse): 18545
Entry
18545             CDS       T01002                                 

Gene name
Pcp2, L, L7, Pcp, Pcp-2
Definition
(RefSeq) Purkinje cell protein 2 (L7)
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: GoLoco
Other DBs
NCBI-GeneID: 18545
NCBI-ProteinID: NP_001123276
MGI: 97508
Ensembl: ENSMUSG00000004630
Vega: OTTMUSG00000032848
UniProt: P12660
Position
8 A1.1; 8 1.92 cM
AA seq 120 aa
MAGSPDQEGFFNLLTHVQGDRMEEQRCSLQAGPGQNPESQGGPAPEMDNLMDMLVNTQGR
RMDDQRVTVNSLPGFQPIGPKDGMQKRPGTLSPQPLLTPQDPAALSFRRNSSPQPQTQAP
NT seq 363 nt   +upstreamnt  +downstreamnt
atggcaggttcaccggaccaggaaggcttcttcaacctgctgacccacgtgcagggcgat
cggatggaggagcagcgctgttccttgcaggctgggccaggccagaacccagaaagccag
ggtggccctgctccagagatggacaatctcatggatatgctggtcaacacccagggccgc
cgcatggacgaccagcgtgtaacagttaattccctgcctggcttccaacctatcggcccc
aaggatggaatgcagaaacgacctgggaccctcagccctcaacccctgctcacccctcag
gatcctgctgcactcagcttccgcaggaacagcagcccccagccccagacacaagctcct
tga

DBGET integrated database retrieval system