KEGG   Mus musculus (mouse): 18563Help
Entry
18563             CDS       T01002                                 

Gene name
Pcx, Pc, Pcb
Definition
(RefSeq) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    18563 (Pcx)
   00620 Pyruvate metabolism
    18563 (Pcx)
Enzymes [BR:mmu01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     18563 (Pcx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp_3 RnfC_N NQRA PTS_EIIA_1
Motif
Other DBs
NCBI-GeneID: 18563
NCBI-ProteinID: NP_001156418
MGI: 97520
Ensembl: ENSMUSG00000024892
UniProt: Q3UFS6 E9QPD7 Q8BP54
Position
19 A; 19 4.07 cM
AA seq 1179 aa AA seqDB search
MMLKFQTVRGGLRLLGVRRSSSAPVASPNVRRLEYKPIKKVMVANRGEIAIRVFRACTEL
GIRTVAVYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENGVDAVHPGYG
FLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDSPISSLHE
AHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFI
EKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPATHLDPQLRSRLTSDSVKLA
KQVGYENAGTVEFLVDKHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVSEGRSLPD
LGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVIS
PHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIPFLQNVLNNQQFLAGTVDTQ
FIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVNVSPSPVDPAVPVVPIGPPPA
GFRDILLREGPEGFARAVRNHQGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFN
KLFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVV
FKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYS
LEYYMGLAEELVRAGTHILCIKDMAGLLKPAACTMLVSSLRDRFPDLPLHIHTHDTSGAG
VAAMLACAQAGADVVDVAVDSMSGMTSQPSMGALVACTKGTPLDTEVPLERVFDYSEYWE
GARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQ
MLGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGIPHGGF
PEPFRSKVLKDLPRIEGRPGASLPPLNLKELEKDLIDRHGEEVTPEDVLSAAMYPDVFAQ
FKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFE
LNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVAAGDKVAKGQPLCV
LSAMKMETVVTSPMEGTIRKVHVTKDMTLEGDDLILEIE
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgaagttccaaacagttcgagggggcctgaggctcctgggtgtccgccgatcc
tcctcggcccctgttgcctccccaaatgtccggcgtctggagtataagcctatcaagaaa
gtaatggtggccaacagaggtgagattgccatccgagtgtttcgtgcgtgcacagagctg
ggtatccgcacagtggctgtctactcggagcaggacacagggcagatgcacaggcagaaa
gctgatgaagcctaccttattggccgtggcctggcacctgtgcaggcctacctgcacatt
ccagacatcatcaaggtggccaaggaaaatggtgtagatgcggtgcatcctggctatggg
ttcctctcagagcgagcagactttgcccaggcctgccaagatgctggagtccggttcatt
ggtccaagcccagaggtggtccgcaagatgggagacaaggtggaagcccgggccattgcc
atcgctgcaggcgttccagtggtccccggcacggactcccccatcagctccctgcacgag
gcgcatgagttctccaacacctacggcttccctattatcttcaaggccgcctacggaggt
gggggccgcggcatgcgggtcgtgcatagctatgaggagttggaagagaattacacccgg
gcctactccgaggccttggcagcctttgggaatggagcgttgtttgtggagaagttcatt
gagaagccaaggcacattgaggtgcagatcctaggggaccagtatgggaacatcctgcac
ctgtacgagcgagactgctccatccagcgtcggcaccagaaggtggtagagatcgcccct
gctacccacctggatccccaacttcgctcacgtctcaccagtgactctgtcaaacttgcc
aagcaggtaggctatgagaacgccggcactgtggagttcctggtggacaagcacggcaag
cactacttcatcgaggtcaattcccgcctgcaggtggagcacacggtcaccgaggagatc
acagatgtggacctggtccatgctcagatccacgtgtccgaaggccggagcctgcctgac
ctgggcctgcggcaggagaacatccgcatcaatggctgtgccattcagtgtcgggtcacc
accgaggaccctgcacgcagcttccagccagacaccggccgcattgaggttttccggagt
ggtgagggcatgggcatccgcctggacaacgcctctgcattccagggcgctgtcatatcg
ccccactatgactctctgctcgtcaaggtcattgcacacggcaaagaccaccccacagct
gccaccaagatgagcagagccctggccgagttccgtgtccgaggtgtaaagaccaacatc
cccttcctgcagaatgttctcaacaaccagcagttcctggcaggcacagtggacacccag
ttcatcgatgagaaccctgagctgttccagcttcggcctgcacagaaccgggcccagaag
ttgctacattacctcggacatgtcatggtgaatggccctaccactccaatccctgtcaat
gtgagccccagtcctgtggatcctgctgttcctgtggtgcccataggcccacctccagct
ggtttcagggacatccttctgcgagaagggccagagggctttgcccgagctgtgcggaat
caccaggggctgctgttgatggacacaaccttccgggatgcccaccagtcactactggcc
actagagtgcgcacacatgatctcaaaaagattgcgccctatgttgcccacaacttcaac
aagctcttcagcatggagaactggggaggcgccacgttcgacgttgccatgcgcttcctg
tacgagtgcccctggcggcggctccaggagctccgggagcttatcccgaacatcccgttc
cagatgctactgaggggggccaatgctgtgggctacaccaactaccctgacaacgtggtc
ttcaagttctgtgaggtggccaaagagaatggtatggacgtcttccgagtctttgactcc
ctcaactacttgccaaacatgctgctgggcatggaagcagcaggcagtgctgggggtgtg
gtggaggctgccatctcatacacgggggacgtggctgaccctagtcgcactaaatactca
ctggagtactacatgggcttagctgaagaactggtgcgagctggcactcacatcctgtgc
attaaggacatggcgggcctgctgaagcctgccgcctgcaccatgctggtcagctccctc
cgggaccgattccccgacctcccactgcacatccatacccatgatacatcaggggcaggt
gtggcagccatgctggcctgtgcacaagcaggggctgatgttgtggacgtggcagtagac
tccatgtctgggatgacctcacagccaagcatgggggccctggtggcctgtaccaaaggg
actcctttggacacagaggtacccctggagcgtgtgtttgactacagtgagtactgggaa
ggggctcggggactgtacgcagccttcgattgcacggctaccatgaagtctggcaactcc
gacgtgtatgagaatgagattccagggggccagtacaccaacctgcacttccaggcccat
agcatggggcttggctccaagttcaaggaggtcaagaaggcctatgtggaggctaaccag
atgctgggggacctcatcaaggtgacaccatcctccaagattgtgggggacctggcccag
ttcatggtgcagaatgggttgagccgggcagaggcagaagctcaggcagaagagctgtcc
ttcccccgctctgtggtggagttcctgcagggctacattggcattccccatgggggtttc
cctgagccctttcgctctaaggtgctaaaggacctgccaagaatagaggggcggcctgga
gcctccctccctcccctgaacctgaaggagctggagaaggacctgattgataggcatggg
gaggaggtgaccccagaggacgtcctctctgcagccatgtaccctgatgtctttgctcaa
ttcaaagacttcacggctaccttcggccccctggatagccttaatactcgtctctttctt
caaggacccaaaattgcagaggagtttgaggttgagctggaacggggcaagaccctgcac
atcaaagccctggctgtaagcgacctgaaccgtgctggccagaggcaggtgttctttgaa
ctcaatgggcagcttcgatccattctggttaaagacacccaggccatgaaggagatgcac
ttccatcccaaggctttgaaggatgtgaagggccaaattggggccccgatgcctgggaag
gtcatagacatcaaggtggcagcaggggacaaggtggctaagggccagcccctctgtgtg
ctcagcgccatgaagatggagactgtggtgacttcgcccatggagggcactatccgaaag
gttcatgttaccaaggacatgactctggaaggcgacgacctcatcctagagattgagtga

DBGET integrated database retrieval system