KEGG   Mus musculus (mouse): 18566
Entry
18566             CDS       T01002                                 

Gene name
Pdcd1, Ly101, PD-, PD-1, Pdc, Pdc1
Definition
(RefSeq) programmed cell death 1
  KO
K06744  programmed cell death protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04660  T cell receptor signaling pathway
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    18566 (Pdcd1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    18566 (Pdcd1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    18566 (Pdcd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18566 (Pdcd1)
CD molecules [BR:mmu04090]
 Proteins
  18566 (Pdcd1)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set
Other DBs
NCBI-GeneID: 18566
NCBI-ProteinID: NP_032824
MGI: 104879
Ensembl: ENSMUSG00000026285
Vega: OTTMUSG00000048696
UniProt: Q02242 Q544F3
Structure
PDB: 

Position
1; 1 D
AA seq 288 aa
MWVRQVPWSFTWAVLQLSWQSGWLLEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWS
EDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGI
YLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQGMVIGIMSALVGI
PVLLLLAWALAVFCSTSMSEARGAGSKDDTLKEEPSAAPVPSVAYEELDFQGREKTPELP
TACVHTEYATIVFTEGLGASAMGRRGSADGLQGPRPPRHEDGHCSWPL
NT seq 867 nt   +upstreamnt  +downstreamnt
atgtgggtccggcaggtaccctggtcattcacttgggctgtgctgcagttgagctggcaa
tcagggtggcttctagaggtccccaatgggccctggaggtccctcaccttctacccagcc
tggctcacagtgtcagagggagcaaatgccaccttcacctgcagcttgtccaactggtcg
gaggatcttatgctgaactggaaccgcctgagtcccagcaaccagactgaaaaacaggcc
gccttctgtaatggtttgagccaacccgtccaggatgcccgcttccagatcatacagctg
cccaacaggcatgacttccacatgaacatccttgacacacggcgcaatgacagtggcatc
tacctctgtggggccatctccctgcaccccaaggcaaaaatcgaggagagccctggagca
gagctcgtggtaacagagagaatcctggagacctcaacaagatatcccagcccctcgccc
aaaccagaaggccggtttcaaggcatggtcattggtatcatgagtgccctagtgggtatc
cctgtattgctgctgctggcctgggccctagctgtcttctgctcaacaagtatgtcagag
gccagaggagctggaagcaaggacgacactctgaaggaggagccttcagcagcacctgtc
cctagtgtggcctatgaggagctggacttccagggacgagagaagacaccagagctccct
accgcctgtgtgcacacagaatatgccaccattgtcttcactgaagggctgggtgcctcg
gccatgggacgtaggggctcagctgatggcctgcagggtcctcggcctccaagacatgag
gatggacattgttcttggcctctttga

DBGET integrated database retrieval system