KEGG   Mus musculus (mouse): 18567
Entry
18567             CDS       T01002                                 

Gene name
Pdcd2, AI528543, Pcd2, RP, RP-8
Definition
(RefSeq) programmed cell death 2
  KO
K14801  pre-rRNA-processing protein TSR4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    18567 (Pdcd2)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    18567 (Pdcd2)
SSDB
Motif
Pfam: PDCD2_C zf-MYND
Other DBs
NCBI-GeneID: 18567
NCBI-ProteinID: NP_032825
MGI: 104643
Ensembl: ENSMUSG00000014771
Vega: OTTMUSG00000032972
UniProt: P46718 A0A0R4J0N5
Position
17 A2; 17 8.95 cM
AA seq 343 aa
MAAAAPGPVELGFAEEAPAWRLRSEQFPSKVGGRPAWLGLAELPGPGALACARCGRPLAF
LLQVYAPLPGRDDAFHRSLFLFCCREPPCCAGLRVFRNQLPRNNAFYSYEPPSETEALGT
ECVCLQLKSGAHLCRVCGCLAPMTCSRCKQAHYCSKEHQTLDWRLGHKQACTQSDKIDHM
VPDHNFLFPEFEIVTETEDEILPEVVEMEDYSEVTGSMGGIPEEELDSMAKHESKEDHIF
QKFKSKIALEPEQILRYGRGIKPIWISGENIPQEKDIPDCPCGAKRIFEFQVMPQLLNHL
KADRLGRSIDWGVLAVFTCAESCSLGSGYTEEFVWKQDVTDTP
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggctgcagccgcccctggtcctgtggagttgggcttcgccgaggaggcaccggcctgg
aggctgcgcagcgagcagtttcccagcaaagtgggcgggcggcccgcgtggttgggcttg
gcggagctgccggggcccggggcgctggcgtgtgcgcgctgcggccgcccgctcgccttc
ctgctgcaggtgtacgcaccgctgccgggccgggacgacgccttccaccgcagcctcttt
ctcttctgctgtcgcgagccgccgtgctgcgccggcctgcgagtttttcgtaatcagcta
ccaaggaacaacgcattctactcctatgagcccccttctgaaacagaagctttgggtacg
gaatgtgtgtgcctccagctcaagtctggagcccatctctgtcgggtttgtggttgcttg
gcccctatgacatgctctaggtgcaaacaggcacattactgcagcaaggagcatcagaca
ttagactggcggctgggacacaagcaggcttgtacacagtcagacaaaatagaccatatg
gttccagaccacaacttcctgtttccagaatttgaaattgtaacagaaacagaagatgaa
attttgcctgaggttgtggaaatggaggattattctgaagttacaggaagcatgggggga
attcctgaggaagaactagattccatggcaaagcacgaatccaaggaagatcacatattc
caaaagtttaaatctaaaatagcccttgaaccagagcagattctcaggtatggaagaggg
attaaacccatctggatttctggtgaaaatattcctcaagaaaaagatattccagattgc
ccgtgtggtgccaagagaatatttgaattccaggtcatgcctcagctgttgaaccacctg
aaggcagacagactcggcagaagcatcgactggggtgtcttggctgtcttcacctgtgct
gagagctgtagcctgggtagcggctacacagaagaatttgtgtggaagcaggatgtgaca
gatacaccttaa

DBGET integrated database retrieval system