KEGG   Mus musculus (mouse): 18570Help
Entry
18570             CDS       T01002                                 

Gene name
Pdcd6, AV299538, Alg2, MA-3, PS2, alg-2
Definition
(RefSeq) programmed cell death 6
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 XS PgpA
Motif
Other DBs
NCBI-GeneID: 18570
NCBI-ProteinID: NP_035181
MGI: 109283
Ensembl: ENSMUSG00000021576
UniProt: P12815
Structure
PDB: 

Position
13; 13 C1
AA seq 191 aa AA seqDB search
MAAYSYRPGPGGGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDNELQQALSNGTWTPF
NPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALS
GFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSY
EQYLSMVFSIV
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctactcctaccgcccaggcccgggtggtggccccggccctgctgctggagct
gcactgccagaccagagcttcctgtggaacgtcttccagcgggttgataaagacaggagt
ggagtgatttcagacaatgagcttcagcaagcattatccaatggtacatggactccattt
aacccagtgactgtgaggtcaatcatttctatgtttgaccgagaaaacaaggctggtgtg
aacttcagtgaattcacgggtgtgtggaagtatatcacagactggcagaatgtcttccgg
acctacgacagggacaactctgggatgattgacaagaacgagctcaaacaagcactctca
ggttttggctaccggctctctgatcagttccatgacatcctcatccgaaaatttgacagg
caaggacggggccagatcgcatttgatgacttcatccagggctgcatcgtcttgcagagg
ttgacagacatattcagacgctatgacacggatcaggatggctggattcaggtgtcttat
gagcaatatctctccatggtcttcagcattgtataa

DBGET integrated database retrieval system