KEGG   Mus musculus (mouse): 18572
Entry
18572             CDS       T01002                                 

Gene name
Pdcd11, 1110021I22Rik, ALG-4, Pdcd7, mKIAA0185
Definition
(RefSeq) programmed cell death 11
  KO
K14792  rRNA biogenesis protein RRP5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    18572 (Pdcd11)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    18572 (Pdcd11)
SSDB
Motif
Pfam: S1 Suf TPR_14 TPR_19 TPR_12 TPR_15 TPR_6 TPR_7 DUF2110 TPR_1 NRDE-2
Other DBs
NCBI-GeneID: 18572
NCBI-ProteinID: NP_035183
MGI: 1341788
Ensembl: ENSMUSG00000025047
UniProt: Q6NS46
Position
19; 19 C3
AA seq 1862 aa
MANLEESFPRGGTRKLHKSEKSSQQVVEQDNLFDVSTEEGPIKRKKSQKGPAKTKKLKIE
KRKSIKSIKEKFEILSLESLCEGMRILGCVKEVSELELVVSLPNGLQGFVQVTEVCDAYT
QKLNEQVAQEEPLEDLLRLPELFSPGMLVRCVVSSLDVTESGKKSVKLSVNPKRVNKVLS
ADALRPGMLLTGTVSSLEDHGYLVDIGVGGTRAFLSLKKAQEYIRQKNKGAKFKVGQYLT
CVVEEVKSNGGVVSLSVEHSEVSSAFATEEQSWNLNNLLPGLLVKAQVQKVTQFGLQLNF
LTFFKGLVDFMHLEPKKMGSYSSNQTVKACILCVHPRTRVVRLSLRPIFLHPGRPLTRIS
YQQLGAVLDDVPVQGFFKNAGAIFRLKDGVLAYARVSHLSDSKKAFNAEAFKPGSTHKCR
IIDYSQMDELALLSLRKSIIAAPFLRYHDIKIGTVVKGTVLAIKPFGILVKVGEQIKGLV
PSMHLADIMMKNPEKKYSPGDEVKCRVLLCDPEAKKLIMTLKKTLVTSKLSLITCYEGAK
PGLQTHGVIIRVKDYGCIVKFYNDVQGLVPKHELSTQHIPDPETVFYTGQVVKVAVLSCE
PSKERMLLSFRLLSDSRPKDPGVESSQKKTGAVRIGQLVDVKVLEKTKTGLEVAILPHNT
PAFLPTPHLSDHAANGPLLHHWLQTGDTLHRVLCLSQSERHILLCRKPALVSTVEGGQDP
KSLSEIQPGMLLIGFVKCIKEYGVFVQFPSGLSGLSPKTIMSDKFVTTPSEHFVEGQTVV
AKVTNVDESKQRMLLSLRLSDCSLGDSASTSFLLLCQCLEELQGIRSLMSNQDSVLIQTL
ADMTPGMVLDAVVHEVLEDGSVVFSSDPVPDLVLRASRYHRAGQEVEPGQKKKVVVLHVD
MLKLEVHVSLHQDLVNRKTRKLRKSSRHQGIVQHLEESFAVASLVETGHLVAFSLISHLN
DTFHFDSEKLRVGQGVCLTLKTTEPGVTGLILAVEGPASKRTRMPVQRDSETVDDKGEEK
EEEEEEEEKEEENLTVKSKKRHSLAIGDKVTGTIKAVKATHVVVTLADGFVGCIHASRIL
DDVPVGTSPTTTLKAGKKVTARVIGGRDVKTSKFLPISHPRFVLTILELSVRPSELKGSY
SALNTHSESPVEKIRQYQAGQTVTCFFKKYNVMKKWLEVDIGPDIRGRIPLLLTSLSFKV
LKHPDKKFQVGQAIEATVVDPDVPRAFLCLSLIGPYRLEEGEVAMGRVMKVVPNRGLTVS
FPFGKIGKVSMFHLSDSYSEAPLEDFCPQKIVRCYILSTAHRVLALSLRSSRTNRETKNR
IEDPEINSIEDVKEGQLLRGYVKCVLPSSVIIGLGPSVLGLAKYSHVSECVPPEKELYNG
CLPEGKLVTAKVLRVNPMKNLIELSLLPSDTGRPDVFSPAPEPKQEERSGGAEEGQKRKE
KNQKRREEKEEPQKSQRGGRGKRERQESESEQELVNKRPKKSGAAEEDDSGVEVYYREGE
DEVGEPKLPPRGKQTKSTEVPRLHLSSGFLWDVGLDSLTPALPLREESSDSEDEQPHQAK
KKKGKKERELEKQKAEKELSRIEEALMDPGRQPESADDFDRLVLSSPNSSILWLQYMAFH
LQATEIEKARAVAERALKTISFREEQEKLNVWVALLNLENMYGSQESLTKVFERAVQYNE
PLKVFLHLADIYTKSEKYKEAGELYNRMLKRFRQEKAVWIKYGAFVLGRSQAGASHRVLQ
RALECLPAKEHVDVIVKFAQLEFQLGDVERAKAIFENTLSTYPKRTDVWSVYIDMTIKHG
SQTAVRDIFERVIHLSLAPKRMKFFFKRYLDYEKQHGTEKDVQAVKAKALEYVEAKSSAL
ED
NT seq 5589 nt   +upstreamnt  +downstreamnt
atggcaaacctggaggaaagcttcccccgaggggggacacggaaactccacaaatcagag
aagtcttcccagcaggtggttgaacaagacaacttatttgatgtttccacagaagaaggt
cccattaaaaggaaaaagagccagaaagggccagcaaaaacaaaaaaattgaaaattgaa
aagagaaaatccatcaaatctataaaagagaagtttgaaattcttagtcttgagtcccta
tgtgaggggatgcggattttgggctgtgtgaaggaggtgagtgagctggagctggtggtc
agccttcccaacggcctccaagggtttgtgcaagtgaccgaagtctgtgacgcctacact
cagaagctgaatgagcaggtggcacaagaagaacctctggaggacctgctccgcctgcct
gagctcttctcccctggaatgttggtgaggtgtgtggtgagcagcctggatgtcacagag
agtggcaagaagagcgtcaagctttctgtgaaccccaaacgtgtcaacaaagtgctgagt
gctgatgccctgaggcctggcatgctgctgacaggcacagtgtcaagcctggaagaccat
ggctacctagtggacattggcgttggtgggaccagagcttttctgtcacttaagaaggca
caagagtacatccggcagaagaacaaaggtgctaagttcaaagtcggccagtacctgacc
tgtgtggttgaagaggtgaaaagcaacggaggagttgtgagtctctctgtagagcactcc
gaggtttcctctgccttcgcaactgaggagcaaagctggaacctgaataacttactacca
gggctgctggtcaaagcccaggtgcagaaggtaactcagtttggactccagctaaatttc
cttacgttcttcaagggcctggttgacttcatgcatctggagcccaagaaaatgggatct
tattcttcaaatcaaacggtaaaagcctgcatcctctgcgtccatcctcgcaccagagtt
gtgcgactgagcctgcgccccatcttcctgcatcctgggcgtccactcacccgcatctct
taccagcagctaggggctgtgctagatgatgtccctgttcagggtttttttaagaatgcg
ggggccatcttcaggctgaaggatggggtactggcctacgcccgggtcagccatctctct
gattctaagaaagcattcaacgctgaggccttcaaaccggggagcactcacaagtgtaga
atcattgactacagccagatggatgagctggccttgctctctctgcggaaatcaattatt
gcagctccattccttagatatcatgacatcaaaatagggacagtagtaaagggcacagtg
ctggccataaagccatttgggatcctggtgaaggtgggtgagcagataaaaggcctggtg
ccctccatgcacctggctgacatcatgatgaagaacccagagaagaagtacagcccaggg
gatgaggtcaagtgcagggttttgctctgtgaccctgaagccaagaagctaattatgacc
ctgaaaaaaacccttgtcacatccaaactgtctctcatcacctgctatgagggtgccaag
cctggcctgcagacgcacggtgttatcatacgggtcaaggactatggctgcattgtgaag
ttctacaacgatgtgcaggggctagtgcctaagcatgagcttagcacccagcacatcccg
gacccagagacggtcttttacactggccaggtggtaaaggtggcagtgctgagctgtgag
ccttccaaggagaggatgctcctgtccttcagactgttgagtgactcgcggccaaaggat
ccgggtgttgagagcagtcagaagaaaacaggagctgtgcgcatcgggcagttggtggat
gtgaaggtcctggagaagaccaaaaccgggctggaggtggccatcctgccccataacacc
cctgctttcctccccacgccacacctgtccgaccacgctgccaatggcccactgttgcac
cactggctccagacaggtgacacccttcaccgagttctgtgtttgagccagagtgagaga
cacattcttctttgcaggaaaccagctttggtctccacagtagaaggtggccaggacccc
aagagcctctcagaaatccagcccggaatgttgctcattggttttgtgaagtgcatcaag
gagtatggcgtgttcgtccagttcccctcaggtctcagtggactgtcccccaaaactatc
atgagtgacaagttcgtaaccactccaagtgaacactttgtggagggtcagacagtcgtt
gctaaggtgaccaatgtggatgaatcgaagcagaggatgctgctgtctctgcggctgtca
gactgcagtctgggggattcggccagcaccagcttcctcctcctgtgccagtgcctggaa
gagctgcagggcattcgcagcctcatgagcaaccaagactctgtattgatccagacactt
gctgacatgaccccggggatggtccttgatgccgtggtccatgaggtgttagaagatggt
tcagtggtgttcagtagtgatcctgtgcctgacctggtcctgagagccagcagataccac
cgggcagggcaggaggtggagcctggacagaagaagaaggtcgtggttctacacgtggac
atgttgaagttggaggtccacgtctcccttcaccaggacttggtgaacaggaaaacgaga
aagctgagaaaaagcagtagacaccagggaatcgtacagcatctggaagagtcctttgcc
gtggcatccttggtggagactggccaccttgtggctttctctctgatctctcacctcaat
gataccttccactttgactctgagaagctgcgtgtggggcagggtgtctgccttaccctc
aagaccacagaaccgggagtgaccggtctgattttggctgtggaagggccagcttctaag
aggaccaggatgccagttcagagggattcagagacagttgatgacaaaggagaggagaaa
gaggaggaggaggaggaggaggagaaggaagaagagaacttgactgtgaagtctaagaaa
aggcatagcctggctattggggacaaagtcactgggaccattaaggctgtgaaggccaca
catgttgttgtaaccctagctgatggctttgttggctgtatccatgcctcccgcatctta
gatgatgtcccagtgggcacctcgcctacgaccacactgaaagccgggaagaaagtcact
gcgagagtgatcggtgggcgagatgtgaagacatctaagtttctcccaataagtcacccc
agatttgttctgaccatcctggagctgagtgttcggccaagtgagttgaagggtagctac
agtgctcttaatactcactctgagagccccgtggagaagatcaggcagtaccaggctggg
cagactgtgacctgcttcttcaagaagtacaacgtgatgaagaagtggcttgaagtggac
atcggaccggacatccgagggagaattcccttgttgctcacttccctcagcttcaaggtt
ctgaaacacccagacaagaagttccaggttgggcaggccatcgaggccaccgttgttgac
ccagacgtccccagggctttcttatgtctgtcactcataggaccttacagacttgaagaa
ggtgaagtggccatgggccgagtgatgaaggttgtacccaacaggggactgaccgtctcc
ttcccttttgggaagatagggaaagtcagtatgtttcacctgagcgactcgtactccgag
gcacccctggaggacttctgcccccagaagattgtcagatgttacatcctgtccacagca
caccgtgtgctggctttgtcactccggtcatccaggacaaacagagagacaaaaaacaga
atagaagatccagaaatcaactccattgaggacgtgaaggaagggcagctcctgcggggc
tatgtgaaatgtgtcctgccaagcagtgtgatcataggccttggaccttcagttctgggt
ttggccaagtattcacatgtctctgagtgtgtcccaccagagaaagagctttataacgga
tgcctccctgagggaaagctggtcactgccaaggtcctgcgcgtgaaccccatgaagaac
ctgatagagctgtcgctccttcccagcgacactgggaggccagacgtgttctctcctgct
ccagaaccaaaacaagaggagaggagcggaggggctgaggagggccagaaaaggaaagag
aagaaccagaagagacgggaggagaaggaagagccccagaagtcacagaggggtgggcga
ggcaagcgggagcgccaggagtctgagagcgagcaggaactagtgaacaagaggccaaag
aagtctggagccgcagaagaagacgacagtggtgtggaagtgtactaccgggaaggagag
gatgaggtgggggagccgaagctgccacccagggggaagcagacaaaatccacagaggtg
ccccggctgcatctctcttcaggcttcctttgggatgtggggcttgactctctgactcca
gccttgccactccgagaagagagctcagacagcgaggatgagcagccgcaccaagctaag
aagaagaagggcaagaaggagagggagctggagaagcagaaggcagagaaggagctgtcg
cgcattgaggaggcactcatggaccctgggcgacagccagagtctgcggatgactttgac
cggctggtgctaagctctcccaacagctccatcctttggctgcagtacatggctttccac
ctacaggccacggagatcgagaaggcccgggctgtggctgagagggccctgaagaccatc
tcattcagagaggagcaggagaagctgaacgtgtgggtggccctgctgaacctggaaaac
atgtacggctctcaggagtccctgactaaggtcttcgagcgagctgtgcagtacaacgag
cctctcaaggttttcctgcatctggctgacatctacaccaagtccgagaaatacaaggaa
gctggtgagctgtacaaccggatgctgaaacggttccggcaggagaaggctgtctggatc
aaatatggtgcctttgttttggggaggagtcaggctggggccagtcaccgagtgctgcag
cgagccctggagtgcctgcccgccaaggaacatgtggatgtgatcgtcaagtttgcccag
ctggagttccagctcggggacgtggagcgcgctaaagccatttttgaaaacacactgagc
acctaccccaaacgcacagacgtctggtcagtctacatcgacatgaccatcaagcacggc
agccagacagcagtcagggacatctttgagcgggtcattcacctgagcctggcgcctaag
aggatgaagttctttttcaagcgctacctggactatgagaagcagcacggcacggagaag
gacgtgcaggcggtcaaggccaaggccttggagtatgtggaggccaagagctcggcgctg
gaggactag

DBGET integrated database retrieval system