KEGG   Mus musculus (mouse): 18573Help
Entry
18573             CDS       T01002                                 

Gene name
Pde1a, AI987702, AW125737
Definition
(RefSeq) phosphodiesterase 1A, calmodulin-dependent
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu04020  Calcium signaling pathway
mmu04740  Olfactory transduction
mmu04742  Taste transduction
mmu04924  Renin secretion
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    18573 (Pde1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    18573 (Pde1a)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    18573 (Pde1a)
  09157 Sensory system
   04740 Olfactory transduction
    18573 (Pde1a)
   04742 Taste transduction
    18573 (Pde1a)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    18573 (Pde1a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     18573 (Pde1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PDEase_I_N
Motif
Other DBs
NCBI-GeneID: 18573
NCBI-ProteinID: NP_001153054
MGI: 1201792
Ensembl: ENSMUSG00000059173
Vega: OTTMUSG00000013315
UniProt: Q61481
Position
2; 2 C3
AA seq 545 aa AA seqDB search
MGSTDTDIEELENATYKYLIGEQTEKMWQRLKGILRCLVKQLEKGDVNVVDLKKNIEYAA
SVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMMKKKPEEKPKFRS
IVHAVQAGIFVERMYRKNYHMVGLTYPAAVIVTLKEVDKWSFDVFALNEASGEHSLKFMI
YELFTRYDLINRFKIPVSCLIAFAEALEVGYSKHKNPYHNLVHAADVTQTVHYIMLHTGI
MHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLM
QEEEMNILVNLSKDDWRDLRNLVIEMVLATDMSGHFQQIKNIRNSLQQPEGIDRAKTMSL
ILHAADISHPAKTWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF
IDFIVEPTFSLLTDSTEKIVIPLIEEASKSQSSNYGASSSSTMIGFHVADSLRRSNTKGS
VCDGSYAPDYSLSAVDLKSFKNNLVDIIQQNKERWKELAAQGELDLHKNSEELGNTEEKH
ADTRP
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggggtctactgatacggacatcgaagaattggaaaacgccacttacaagtatctcatt
ggagaacagaccgagaagatgtggcagcgcctgaagggaatactaagatgcttagtgaag
cagctggagaaaggtgatgtcaacgttgttgacctaaagaagaatatcgaatatgcagca
tcagtactggaagctgtttacatcgatgagacaagaagactgctggacacagaggatgaa
ctcagcgacatccagactgactccgtcccatcggaagtccgggattggttggcttcaact
ttcacacgcaaaatggggatgatgaaaaagaagcctgaagaaaaaccaaagtttcgcagc
attgtccatgctgtccaggctgggatttttgtggaaaggatgtacaggaagaactatcac
atggttggtttgacatatcctgcagctgtcatagtgacactcaaggaagttgataaatgg
tcttttgatgtatttgccttaaatgaagcaagcggggagcatagcctgaagtttatgatt
tatgaactctttaccagatatgatcttatcaaccgcttcaagattcctgtttcttgccta
attgcctttgcagaagccttagaagttggttacagcaagcacaaaaatccatatcataat
ttggtccatgcagctgacgtcactcaaactgtgcattatataatgcttcatacaggtatc
atgcactggctcactgaactggaaattttagccatggtctttgcagctgccattcatgat
tatgagcacacaggaacaacaaacaacttccatattcagacgaggtcggacgttgctatt
ctgtacaacgaccgctcagtgcttgagaatcaccacgtcagcgcagcctacagacttatg
caagaggaggaaatgaatattttggtaaatttgtctaaagatgactggagggatcttcgg
aacttagtgattgaaatggtcttagcgacagacatgtcagggcattttcagcaaattaaa
aacataagaaacagcttgcagcagccggaagggattgacagagccaaaactatgtccctg
atactccatgcagctgacatcagccacccagccaaaacttggaagttgcactacagatgg
accatggccctaatggaggagtttttcctgcagggagacaaagaagctgaattagggctt
ccattttctccactttgtgatcggaagtcaacaatggttgcccagtcgcaaataggtttc
attgatttcatagtggagccaacgttttctctcctgacggactcaacagagaaaattgtc
attcctcttatagaggaagcttcaaagtcacagtcttcaaactacggggcaagcagctcg
tccaccatgattgggttccatgttgctgactctctgaggcggtcaaatacaaaaggctcc
gtgtgtgatgggagctatgccccagactactcgctctcagctgtggatctgaagagtttc
aaaaacaacctggtggacatcattcagcagaacaaagagaggtggaaagagttggctgcc
caaggtgaacttgatcttcataagaactcagaagagttaggaaatactgaagaaaagcat
gctgacacacgtccatag

KEGG   Mus musculus (mouse): 18574Help
Entry
18574             CDS       T01002                                 

Gene name
Pde1b, Pde1b1
Definition
(RefSeq) phosphodiesterase 1B, Ca2+-calmodulin dependent
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu04020  Calcium signaling pathway
mmu04740  Olfactory transduction
mmu04742  Taste transduction
mmu04924  Renin secretion
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    18574 (Pde1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    18574 (Pde1b)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    18574 (Pde1b)
  09157 Sensory system
   04740 Olfactory transduction
    18574 (Pde1b)
   04742 Taste transduction
    18574 (Pde1b)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    18574 (Pde1b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     18574 (Pde1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PDEase_I_N
Motif
Other DBs
NCBI-GeneID: 18574
NCBI-ProteinID: NP_032826
MGI: 97523
Ensembl: ENSMUSG00000022489
UniProt: Q01065 Q6PDS5
Position
15; 15 F3
AA seq 535 aa AA seqDB search
MELSPRSPPEMLESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEVNIEELKKNLE
YTASLLEAVYIDETRQILDTEDELRELRSDAVPSEVRDWLASTFTQQTRAKGRRAEEKPK
FRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVHNCLKNLDLWCFDVFSLNRAADDHALR
TIVFELLTRHSLISRFKIPTVFLMSFLEALETGYGKYKNPYHNQIHAADVTQTVHCFLLR
TGMVHCLSEIEVLAIIFAAAIHDYEHTGTTNSFHIQTKSECAILYNDRSVLENHHISSVF
RMMQDDEMNIFINLTKDEFAELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKSKA
LSLLLHAADISHPTKQWSVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQ
IGFIDFIVEPTFSVLTDVAEKSVQPLADDDSKPKSQPSFQWRQPSLDVDVGDPNPDVVSF
RATWTKYIQENKQKWKERAASGITNQMSIDELSPCEEEAPSSPAEDEHNQNGNLD
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtccccccgcagtcctccagagatgctggagtcggattgcccgtcacccctg
gagctgaagtcagcccccagcaagaaaatgtggattaagctacggtctctgctgcgctac
atggtgaagcagttggagaatggggaggttaacatcgaggagctgaagaaaaacctggaa
tacacagcttccctgctggaagctgtctacattgatgagacaaggcaaatcctagacact
gaagatgagcttcgggaacttcggtcagatgctgtgccttcagaggtgcgggactggttg
gcctccaccttcacccagcagacccgagccaaaggtcgcagggcagaagagaaacccaag
ttccgaagcatcgtgcatgctgtgcaggctgggatcttcgtggagcggatgttccggaga
acgtatacctctgtgggccccacatactctactgcagtccacaactgtctcaagaacctg
gacctctggtgctttgatgtcttttccttgaaccgggcagccgatgaccacgctctgagg
accattgtttttgagttgctgactcggcatagcctcatcagccgctttaagattcccaca
gtgtttctgatgagttttctggaggccttggagacaggctatgggaaatataagaatcct
taccacaaccagatccacgcagccgacgtgacccagactgtccattgcttccttctccgc
acaggcatggtgcactgcctgtcagagattgaggtcttggccatcatctttgctgcagcc
atccatgactatgagcacacaggcacaaccaacagcttccacattcagaccaagtcagaa
tgtgccatcctgtacaatgatcgatcggtgctggagaatcaccacatcagctctgtcttt
cgaatgatgcaggatgatgagatgaacatttttatcaatctcaccaaggatgaatttgca
gagctgcgggccctggttatcgagatggtgttggccacagacatgtcctgccatttccag
caagtgaagactatgaagacagcactgcagcagttggaaaggattgacaagtccaaggcc
ctatctcttctgcttcatgctgctgacatcagccacccaactaagcagtggtcagtccac
agccgctggaccaaggccctaatggaagagttcttccgccagggtgacaaggaggcagag
ctgggcctgcccttctctccactctgtgatcgcacttccacattggtggcccagtcccag
ataggtttcattgacttcattgtggagccaaccttctctgtgctgactgatgtggcagaa
aagagtgtccagcccttggcagatgatgattccaagcctaaaagtcagcccagcttccag
tggcgccagccttctttagatgtggacgtaggagaccccaaccctgatgtggtcagtttc
cgtgccacctggaccaagtacattcaagagaacaaacagaagtggaaggaacgggcagca
agtggcatcaccaaccagatgtccattgatgaactgtccccctgtgaggaagaagcccca
tcctcccctgcagaagatgagcacaaccagaatgggaatctggattag

KEGG   Mus musculus (mouse): 18575Help
Entry
18575             CDS       T01002                                 

Gene name
Pde1c
Definition
(RefSeq) phosphodiesterase 1C
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu04020  Calcium signaling pathway
mmu04740  Olfactory transduction
mmu04742  Taste transduction
mmu04924  Renin secretion
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    18575 (Pde1c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    18575 (Pde1c)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    18575 (Pde1c)
  09157 Sensory system
   04740 Olfactory transduction
    18575 (Pde1c)
   04742 Taste transduction
    18575 (Pde1c)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    18575 (Pde1c)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     18575 (Pde1c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PDEase_I_N
Motif
Other DBs
NCBI-GeneID: 18575
NCBI-ProteinID: NP_001153425
MGI: 108413
Ensembl: ENSMUSG00000004347
Vega: OTTMUSG00000023509
UniProt: Q64338
Position
6 B3; 6 27.65 cM
AA seq 706 aa AA seqDB search
MESPTKEIEEFESNSLKHLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVD
LKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIDALKDVDTWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQEDEEMNILVNLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDESSQTGGTGQRRSSLNSINSSDAKR
SGVKSSGSDGSAPINNSVIPVDYKSFKATWTEVVQINRERWRAKVPKEEKAKKEAEEKAR
LAAEEKQKEMEAKSQAEQGTTSKGEKKTSGEAKSQVNGTRKGDNPRGKNSKGEKAGEKQQ
NGDLKDGKNKADKKDHSNTGNESKKTDGTKKRSHGSPAPSTSSTSRITLPVIKPPLRHFK
RPAYASSSYAPSVPKKTDDHPVRYKMLDQRIKMKKIQNISHHWNKK
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggagtctccaaccaaggaaattgaagaattcgagagcaactctctgaaacacctgcaa
cctgagcagatcgagaaaatctggcttcggctccgcgggctgaggaaatataagaaaacg
tcccagaggttacggtctttggtcaagcaattagaacgaggagaggcctctgtggtagac
cttaagaagaatctggaatatgcagccacagtgcttgaatctgtatatattgatgaaaca
aggcgactgctggatacagaggatgagcttagtgacattcaatcagatgctgtgccttca
gaagttcgggattggctggcctccaccttcacacggcagatggggatgatgcttaggaga
agtgatgagaagcccaggttcaagagcatcgtccatgcggtgcaagctgggatatttgtg
gaaagaatgtacagacggacatcaaacatggttgggctgagctatccaccggctgtaatc
gatgcattgaaggatgtggatacgtggtccttcgatgtcttttccctcaatgaggccagt
ggagatcatgcactgaagttcattttctatgaattactcacacgttatgacctgatcagc
cgttttaagataccgatttctgcacttgtctcatttgtggaggccctcgaagtgggttac
agcaagcacaaaaatccttaccataacctgatgcatgcagctgacgtcacacagactgtg
cattacctcctttataagacaggagtagcaaactggctgacagagctggagatctttgca
ataatcttttcggctgccatccatgactatgaacatactggaactacaaacaatttccac
attcagactcggtcagatccagctatcctgtacaatgacagatctgtcctggagaaccac
cacctgagtgcagcctaccgccttctgcaggaagacgaagagatgaatattctggttaac
ctctcaaaggatgactggagggagtttcgaactttggttattgagatggtaatggccaca
gatatgtcctgtcatttccagcaaatcaaagccatgaagacagccctgcagcaaccagaa
gcaattgagaagccgaaagccttatccctcatgttacacacagcagacatcagtcatcct
gcgaaagcatgggacctgcaccaccgctggaccatgtctctcctggaggagttctttaga
cagggtgacagagaagcagagctggggctgccattttctcctctttgtgacagaaagtca
accatggttgctcagtcacaagtgggttttattgacttcattgtggagcccaccttcact
gtgctcacggacatgaccgagaagattgtgagtccattaattgacgaaagctcccagact
ggtgggacagggcagaggagatcaagtttgaacagcatcaactcatcagatgcaaagcga
tccggtgtcaagagttctgggtcagatggaagtgctcccatcaacaattctgtcattcct
gttgactataagagttttaaagccacttggactgaggtggtgcagatcaatcgggagcgg
tggcgagccaaggtacccaaagaagaaaaagccaagaaggaagctgaagagaaggctcgc
ctggctgctgaggaaaagcaaaaggaaatggaagccaaaagccaagctgaacaaggcaca
accagcaaaggcgagaaaaagacatcaggagaagccaaaagtcaagtcaatggaacacgc
aagggtgataaccctcgtgggaagaactccaaaggagaaaaggcaggcgaaaagcagcag
aacggtgacttgaaagacggtaaaaataaggcagacaagaaggatcactccaacaccgga
aatgagtcaaagaaaacagatggtacaaagaagcgttctcatggctcacctgctccgagc
actagttccacaagtcgcattaccttgccagtcatcaagcctcctttgcgtcactttaag
cgtcctgcttatgcatctagctcctatgcaccttccgtcccgaagaaaactgatgatcat
cctgtaagatacaagatgctggatcagcggatcaagatgaaaaagatccagaacatctct
catcactggaacaaaaaatag

DBGET integrated database retrieval system