KEGG   Mus musculus (mouse): 18575
Entry
18575             CDS       T01002                                 

Gene name
Pde1c
Definition
(RefSeq) phosphodiesterase 1C
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu04020  Calcium signaling pathway
mmu04740  Olfactory transduction
mmu04742  Taste transduction
mmu04924  Renin secretion
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    18575 (Pde1c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    18575 (Pde1c)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    18575 (Pde1c)
  09157 Sensory system
   04740 Olfactory transduction
    18575 (Pde1c)
   04742 Taste transduction
    18575 (Pde1c)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    18575 (Pde1c)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     18575 (Pde1c)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 18575
NCBI-ProteinID: NP_001153425
MGI: 108413
Ensembl: ENSMUSG00000004347
Vega: OTTMUSG00000023509
UniProt: Q64338
Position
6 B3; 6 27.65 cM
AA seq 706 aa
MESPTKEIEEFESNSLKHLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVD
LKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIDALKDVDTWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQEDEEMNILVNLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDESSQTGGTGQRRSSLNSINSSDAKR
SGVKSSGSDGSAPINNSVIPVDYKSFKATWTEVVQINRERWRAKVPKEEKAKKEAEEKAR
LAAEEKQKEMEAKSQAEQGTTSKGEKKTSGEAKSQVNGTRKGDNPRGKNSKGEKAGEKQQ
NGDLKDGKNKADKKDHSNTGNESKKTDGTKKRSHGSPAPSTSSTSRITLPVIKPPLRHFK
RPAYASSSYAPSVPKKTDDHPVRYKMLDQRIKMKKIQNISHHWNKK
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggagtctccaaccaaggaaattgaagaattcgagagcaactctctgaaacacctgcaa
cctgagcagatcgagaaaatctggcttcggctccgcgggctgaggaaatataagaaaacg
tcccagaggttacggtctttggtcaagcaattagaacgaggagaggcctctgtggtagac
cttaagaagaatctggaatatgcagccacagtgcttgaatctgtatatattgatgaaaca
aggcgactgctggatacagaggatgagcttagtgacattcaatcagatgctgtgccttca
gaagttcgggattggctggcctccaccttcacacggcagatggggatgatgcttaggaga
agtgatgagaagcccaggttcaagagcatcgtccatgcggtgcaagctgggatatttgtg
gaaagaatgtacagacggacatcaaacatggttgggctgagctatccaccggctgtaatc
gatgcattgaaggatgtggatacgtggtccttcgatgtcttttccctcaatgaggccagt
ggagatcatgcactgaagttcattttctatgaattactcacacgttatgacctgatcagc
cgttttaagataccgatttctgcacttgtctcatttgtggaggccctcgaagtgggttac
agcaagcacaaaaatccttaccataacctgatgcatgcagctgacgtcacacagactgtg
cattacctcctttataagacaggagtagcaaactggctgacagagctggagatctttgca
ataatcttttcggctgccatccatgactatgaacatactggaactacaaacaatttccac
attcagactcggtcagatccagctatcctgtacaatgacagatctgtcctggagaaccac
cacctgagtgcagcctaccgccttctgcaggaagacgaagagatgaatattctggttaac
ctctcaaaggatgactggagggagtttcgaactttggttattgagatggtaatggccaca
gatatgtcctgtcatttccagcaaatcaaagccatgaagacagccctgcagcaaccagaa
gcaattgagaagccgaaagccttatccctcatgttacacacagcagacatcagtcatcct
gcgaaagcatgggacctgcaccaccgctggaccatgtctctcctggaggagttctttaga
cagggtgacagagaagcagagctggggctgccattttctcctctttgtgacagaaagtca
accatggttgctcagtcacaagtgggttttattgacttcattgtggagcccaccttcact
gtgctcacggacatgaccgagaagattgtgagtccattaattgacgaaagctcccagact
ggtgggacagggcagaggagatcaagtttgaacagcatcaactcatcagatgcaaagcga
tccggtgtcaagagttctgggtcagatggaagtgctcccatcaacaattctgtcattcct
gttgactataagagttttaaagccacttggactgaggtggtgcagatcaatcgggagcgg
tggcgagccaaggtacccaaagaagaaaaagccaagaaggaagctgaagagaaggctcgc
ctggctgctgaggaaaagcaaaaggaaatggaagccaaaagccaagctgaacaaggcaca
accagcaaaggcgagaaaaagacatcaggagaagccaaaagtcaagtcaatggaacacgc
aagggtgataaccctcgtgggaagaactccaaaggagaaaaggcaggcgaaaagcagcag
aacggtgacttgaaagacggtaaaaataaggcagacaagaaggatcactccaacaccgga
aatgagtcaaagaaaacagatggtacaaagaagcgttctcatggctcacctgctccgagc
actagttccacaagtcgcattaccttgccagtcatcaagcctcctttgcgtcactttaag
cgtcctgcttatgcatctagctcctatgcaccttccgtcccgaagaaaactgatgatcat
cctgtaagatacaagatgctggatcagcggatcaagatgaaaaagatccagaacatctct
catcactggaacaaaaaatag

DBGET integrated database retrieval system