KEGG   Mus musculus (mouse): 18576
Entry
18576             CDS       T01002                                 

Gene name
Pde3b, 9830102A01Rik, AI847709
Definition
(RefSeq) phosphodiesterase 3B, cGMP-inhibited
  KO
K13296  cGMP-inhibited 3',5'-cyclic phosphodiesterase B [EC:3.1.4.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04371  Apelin signaling pathway
mmu04910  Insulin signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04922  Glucagon signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04924  Renin secretion
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    18576 (Pde3b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    18576 (Pde3b)
   04024 cAMP signaling pathway
    18576 (Pde3b)
   04022 cGMP-PKG signaling pathway
    18576 (Pde3b)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    18576 (Pde3b)
   04922 Glucagon signaling pathway
    18576 (Pde3b)
   04923 Regulation of lipolysis in adipocytes
    18576 (Pde3b)
   04914 Progesterone-mediated oocyte maturation
    18576 (Pde3b)
   04924 Renin secretion
    18576 (Pde3b)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    18576 (Pde3b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     18576 (Pde3b)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 18576
NCBI-ProteinID: NP_035185
MGI: 1333863
Ensembl: ENSMUSG00000030671
Vega: OTTMUSG00000025593
UniProt: Q61409 E9QLQ3 Q3UQ25
Position
7 F1; 7 59.46 cM
AA seq 1099 aa
MRKDERERDAPAMRSPPPPPASAASPPESLRNGYVKSCVSPLRQDPPRSFFFHLCRFCNV
EPPAASLRAGARLSLGVLAAFVLAALLGARPERWAAAAAGLRTLLSACSLSLSPLFSIAC
AFFFLTCFLTRAQRGPGRGAGSWWLLALPACCYLGDFAAWQWWSWLRGEPAAAGRLCLVL
SCVGLLTLAPRVRLRHGVLVLLFAGLVWWVSFSGLGALPPALRPLLSCLVGGAGCLLALG
LDHFFHVRGASPPPRSASTAEEKVPVIRPRRRSSCVSLGESAAGYYGSGKMFRRPSLPCI
SREQMILWDWDLKQWCKPHYQNSGGGNGVDLSVLNEARNMVSDLLIDPSLPPQVISSLRS
ISSLMGAFSGSCRPKINSFTPFPGFYPCSEVEDPVEKGDRKLHKGLSGRTSFPTPQLRRS
SGASSLLTNEHCSRWDRSSGKRSYQELSVSSHGCHLNGPFSSNLFTIPKQRSSSVSLTHH
AGLRRAGALPSHSLLNSSSHVPVSAGSLTNRSPIGFPDTTDFLTKPNIILHRSLGSVSSA
ADFHQYLRNSDSNLCSSCGHQILKYVSTCEPDGTDHPSEKSGEEDSSVFSKEPLNIVETQ
EEETMKKACRELFLEGDSHLMEEAQQPNIDQEVSLDPMLVEDYDSLIEKMNNWNFQIFEL
VEKMGEKSGRILSQVMYTLFQDTGLLETFKIPTQEFMNYFRALENGYRDIPYHNRVHATD
VLHAVWYLTTRPIPGLPQIHNNHETETKADSDGRLGSGQIAYISSKSCCIPDMSYGCLSS
NIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWNLYLS
RPEYNFLLNLDHMEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVNSNGIEWSSEND
RLLVCQVCIKLADINGPAKDRDLHLRWTEGIVNEFYEQGDEEATLGLPISPFMDRSSPQL
AKLQESFITHIVGPLCNSYDAAGLLPGQWIETEEGDDTESDDDDDDDDGGGEELDSDDEE
TEDNLNPKPQRRKGRRRIFCQLMHHLTENHKIWKEIIEEEEEKCKAEGNKLQVDNASLPQ
ADEIQVIEEADEEEEQMFE
NT seq 3300 nt   +upstreamnt  +downstreamnt
atgaggaaagacgagcgcgagcgggacgcgccagccatgaggtccccgccgccgccgcca
gcctcggccgcctcgccccccgagagcctgcgcaacggctacgtgaagagctgcgtgagc
ccgctgcggcaggaccctccgcgcagcttcttcttccacctctgccgcttctgcaacgtg
gagccgccggcggcctcgctccgcgccggggcacgcctctcgctcggcgtcctggccgcc
tttgtcctggccgcgctgctgggcgcgaggcccgagcgctgggcggccgcggcagccggg
ctccggacgctgctgagcgcctgctcgctcagcctcagcccgctcttcagcatcgcctgt
gccttcttcttcctcacctgtttcctgacgcgcgcgcagcgcggcccgggccgcggcgcc
ggctcctggtggctgctggcgctgcccgcctgctgctacctgggcgacttcgcggcgtgg
cagtggtggtcgtggctgcgtggggagccggcggcggcgggccggctctgcctggtgctg
agctgcgtggggctgctgacgctcgcgccccgcgtgaggctgcggcacggcgtcctggtg
ctgctcttcgccggcctggtgtggtgggtgtccttctccggcctcggggctctgccgccc
gcgctcaggcctctgctgtcgtgcctggtcgggggcgcgggatgcctgctagccctgggc
ttggaccacttctttcacgtccggggagcctcccctccgccgcgctcggcgagtaccgcg
gaggaaaaagtgcctgtgatcagaccccggaggaggtccagctgcgtgtcgctgggagaa
agcgcagccggttactatggcagtggcaagatgttcaggagaccgtcgttgccttgtatt
tcccgagaacagatgatcctctgggactgggacttgaagcagtggtgtaaacctcattac
cagaattctggaggtggaaatggagttgatctttcagtgctaaatgaagctcgcaatatg
gtgtcagacctgctgattgacccaagccttcccccacaagtcatttcttctctgcggagt
atcagtagcttgatgggtgctttctcaggttcctgtaggccaaagattaattcttttaca
ccatttcctggattttatccctgctctgaagtagaagatccagttgagaaaggagatcga
aaacttcacaagggattgagtggcagaaccagtttcccaactccacagctgaggaggagc
tctggagcctcatcgttgctgactaatgagcactgttcaaggtgggatcgcagcagtggt
aagaggtcttaccaagaactcagtgtttcaagtcatggatgccacctaaatgggcctttt
agttcaaatctttttacaattccaaagcagaggtcatcgtctgtgtcactgacgcaccat
gcaggtctgagaagagctggtgctttgcccagccacagtcttctgaattcttcaagccat
gtaccagtgtctgctggctctctaactaatcgatcacccataggatttcctgataccact
gattttcttactaagccaaatattattttacatagatcactgggcagtgtatcaagtgca
gcagatttccatcagtaccttaggaactctgacagcaatctgtgtagcagctgtggacac
caaatactcaaatatgtttcaacatgtgaacccgatggtacagaccaccccagtgaaaaa
tcaggtgaagaagacagcagtgttttctcaaaagaaccattgaacattgtggaaacccaa
gaagaagagaccatgaagaaagcctgcagggagttatttttggaaggtgatagtcacctg
atggaagaggcacagcaaccaaatatcgatcaggaagtgtcactggatccaatgttagta
gaagattatgattcattaatagaaaagatgaacaactggaattttcagatttttgagctt
gtagaaaagatgggagaaaaatcaggaaggattctcagtcaggttatgtatactttattt
caagatactggtttattggaaacatttaaaattcccactcaagaatttatgaattatttt
cgtgccttagaaaatggctaccgggacattccatatcacaatcgtgtgcatgccacagat
gtcctacatgctgtttggtatttgacaacccgaccaattcctggcttacctcagatccat
aataaccatgaaacggaaaccaaagcagattcagatggtagacttggttctggacagatt
gcttacatttcttcgaagagttgctgtattccagatatgagttatggctgcctatcttca
aacatccctgcattagaattgatggctttgtatgtggcagctgccatgcacgattacgat
cacccaggaagaacaaatgcgtttctagtggctacaaatgcacctcaggcagttttatac
aatgacagatctgttctagagaatcatcatgctgcatcagcttggaatctgtatctttct
cgcccagagtacaacttcctccttaaccttgatcacatggaattcaagcggtttcgattt
ttagttatagaagcaatccttgctacagatctcaaaaaacattttgatttccttgcagaa
ttcaatgccaaggccaatgatgtaaatagtaacggtatagaatggagcagtgaaaacgat
cgcctcttggtctgccaggtgtgcatcaaattagcagatatcaatggcccagcaaaagat
cgggacctacatttgagatggacagaaggcattgtgaatgaattttatgagcagggagat
gaagaagcaaccctgggtctacctattagtcccttcatggatcgttcttctcctcaacta
gcaaaactccaagaatcttttatcacccacattgtgggccccctgtgcaactcctatgat
gctgctggcttgctgccgggtcagtggatagaaacagaagagggtgatgatacagaaagt
gatgatgatgatgatgatgatgatggtggtggtgaagaattagattcagatgatgaagaa
acagaagacaatctaaatcctaaaccacaaagaaggaaaggcaggcggcgaatattttgc
caactaatgcaccacctcactgaaaaccacaagatatggaaggaaatcatagaagaagaa
gaagaaaaatgtaaagctgaggggaacaaactgcaggtggataatgcctccttacctcag
gcagatgagattcaggttattgaagaagcagatgaagaggaagaacaaatgtttgaatga

DBGET integrated database retrieval system