KEGG   Mus musculus (mouse): 18582Help
Entry
18582             CDS       T01002                                 

Gene name
Pde6d, AI841218, PrBP/delta
Definition
(RefSeq) phosphodiesterase 6D, cGMP-specific, rod, delta
  KO
K13758  retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    18582 (Pde6d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18582 (Pde6d)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    18582 (Pde6d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GMP_PDE_delta
Motif
Other DBs
NCBI-GeneID: 18582
NCBI-ProteinID: NP_032827
MGI: 1270843
Ensembl: ENSMUSG00000026239
Vega: OTTMUSG00000021876
UniProt: O55057 Q3TDQ8
Structure
PDB: 

Position
1; 1 C5
AA seq 150 aa AA seqDB search
MSAKDERARDILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVS
RELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPA
SVLTGNVIIETKFFDDDLLVSTSKVRLFYV
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccaaggacgagcgggccagggatatcctgagaggcttcaaactaaattggatg
aaccttcgggatgccgaaacagggaagatactctggcaaggaacagaagacctgtctgtc
cctggtgtggaacatgaagcccgtgtgcccaagaaaatcctcaagtgcaaggcagtgtct
cgagaattgaacttttcttcagcagaacaaatggaaaaattccgcctggaacaaaaagtt
tacttcaaaggacaatgcctagaagagtggttcttcgagtttggctttgtgatccctaac
tccacaaacacctggcagtccttgatagaagcagcgcctgagtcccagatgatgcccgcc
agcgtcctaacgggcaatgtcatcatagagacaaagttctttgacgatgatcttcttgtc
agcacatccaaagtgaggcttttctatgtttga

DBGET integrated database retrieval system