KEGG   Mus musculus (mouse): 18585Help
Entry
18585             CDS       T01002                                 

Gene name
Pde9a, PDE9A1
Definition
(RefSeq) phosphodiesterase 9A
  KO
K13761  high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9 [EC:3.1.4.35]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    18585 (Pde9a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     18585 (Pde9a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I AAA_lid_10
Motif
Other DBs
NCBI-GeneID: 18585
NCBI-ProteinID: NP_001157220
MGI: 1277179
Ensembl: ENSMUSG00000041119
Vega: OTTMUSG00000033902
UniProt: O70628 Q8BSU4
Position
17; 17 B1
AA seq 534 aa AA seqDB search
MGAGSSSYRPKAIYLDIDGRIQKVVFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAM
VSIDPTMPANSERTPYKVRPVAVKQVSEREELIQGVLAQVAEQFSRAFKINELKAEVANH
LAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARNSRTNCPCKYSFLDNKKLTPRRDVP
TYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPITLRRWLLC
VHDNYRNNPFHNFRHCFCVTQMMYSMVWLCGLQEKFSQMDILVLMTAAICHDLDHPGYNN
TYQINARTELAVRYNDISPLENHHCAIAFQILARPECNIFASVPPEGFRQIRQGMITLIL
ATDMARHAEIMDSFKEKMENFDYSNEEHLTLLKMILIKCCDISNEVRPMEVAEPWVDCLL
EEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPVVEETMLR
PLWESREHYEELKQLDDAMKELQKKTESLTSGAPENTTEKNRDAKDSEGHSPPN
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgggggccggctcctcaagctaccggcccaaggccatctacctagacatcgatggacgc
atccagaaggtggttttcagcaagtactgcaactccagtgacatcatggacctgttctgt
atcgccaccggcctgcctcggaacaccaccatctcccttttaaccacagacgacgccatg
gtctccatcgatcccaccatgcctgcgaattcagagcgcactccctacaaggtgagacct
gtggctgtgaagcaagtgtctgaacgagaagaacttatccagggcgtgctggcccaggtg
gcggaacaattttccagagcgtttaagatcaacgagctgaaagccgaagttgcaaatcac
ctggccgtgctggagaaacgggtggaattggaaggacttaaagtggtggagatcgaaaaa
tgcaagagtgacattaaaaagatgcgggaggagttggcagctaggaacagcaggaccaac
tgtccatgtaaatacagttttttggataacaagaagttgacacctcgacgtgatgtcccc
acttaccccaagtacctgctctccccagagaccatcgaagccctacggaagcccaccttt
gatgtctggctttgggaacccaacgagatgctgagctgtttagaacatatgtaccacgac
cttggtctggtcagggacttcagcatcaacccaatcacgctccgcaggtggctgctctgt
gtgcatgacaactacaggaacaaccccttccacaacttccggcactgcttctgtgtgaca
cagatgatgtacagtatggtctggctctgtggcctccaggagaagttttcccagatggac
atcttggtcctgatgactgcagccatctgccatgacctggaccacccagggtacaacaat
acataccagatcaatgcccgcacggaactcgctgtgcgctacaacgacatctcaccgctg
gagaaccaccactgcgccattgccttccagatcctggcaagacctgagtgcaacatcttc
gccagtgtgccacccgagggcttcaggcagatcaggcaggggatgatcacattgatcctg
gctaccgacatggcaaggcatgctgaaattatggattctttcaaagaaaagatggagaat
tttgactacagcaacgaggagcacctgaccctgctgaagatgattctcataaaatgctgt
gatatctccaatgaagtccgtcccatggaggtggcagaaccgtgggtggactgtttactg
gaagaatattttatgcagagtgaccgtgagaagtccgaaggccttcctgtggccccattc
atggaccgagacaaagtgaccaaagcaacagcccaaattgggttcatcaagtttgtcctg
atcccaatgtttgaaacagtgaccaagctcttccccgttgttgaggagaccatgctgcgg
ccgctctgggagtcccgagaacactacgaggagctgaagcagctggacgatgccatgaag
gagttgcagaagaagacagagagcttaacatctggggccccggaaaacaccacagagaag
aacagagatgcaaaagacagtgaaggccattctcctccaaactga

DBGET integrated database retrieval system