KEGG   Mus musculus (mouse): 18606
Entry
18606             CDS       T01002                                 

Symbol
Enpp2, AT, ATX, Auto, E-NPP_2, N, Npps2, PD-, PD-Ialpha, Pd, Pdnp2, lysoPLD
Name
(RefSeq) ectonucleotide pyrophosphatase/phosphodiesterase 2
  KO
K01122  ectonucleotide pyrophosphatase/phosphodiesterase family member 2 [EC:3.1.4.39]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00565  Ether lipid metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    18606 (Enpp2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.39  alkylglycerophosphoethanolamine phosphodiesterase
     18606 (Enpp2)
SSDB
Motif
Pfam: Phosphodiest Somatomedin_B Endonuclease_NS Sulfatase
Other DBs
NCBI-GeneID: 18606
NCBI-ProteinID: NP_056559
MGI: 1321390
Ensembl: ENSMUSG00000022425
Vega: OTTMUSG00000037584
UniProt: Q9R1E6
Structure
PDB: 

Position
15; 15 D1
AA seq 862 aa
MARQGCFGSYQVISLFTFAIGVNLCLGFTASRIKRAEWDEGPPTVLSDSPWTNTSGSCKG
RCFELQEVGPPDCRCDNLCKSYSSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHCS
EDCLSRGDCCTNYQVVCKGESHWVDDDCEEIRVPECPAGFVRPPLIIFSVDGFRASYMKK
GSKVMPNIEKLRSCGTHAPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDAT
FHLRGREKFNHRWWGGQPLWITATKQGVRAGTFFWSVSIPHERRILTILQWLSLPDNERP
SVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKTVGQLMDGLKQLKLHRCVNVIFVGDHG
MEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRPKIPNNLKYDPKAIIANLTCKKPDQHF
KPYMKQHLPKRLHYANNRRIEDLHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNKV
NSMQTVFVGYGPTFKYRTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTFR
PTLPEEVSRPNYPGIMYLQSDFDLGCTCDDKVEPKNKLEELNKRLHTKGSTEERHLLYGR
PAVLYRTSYDILYHTDFESGYSEIFLMPLWTSYTISKQAEVSSIPEHLTNCVRPDVRVSP
GFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWTYFQRVLV
KKYASERNGVNVISGPIFDYNYNGLRDIEDEIKQYVEGSSIPVPTHYYSIITSCLDFTQP
ADKCDGPLSVSSFILPHRPDNDESCNSSEDESKWVEELMKMHTARVRDIEHLTGLDFYRK
TSRSYSEILTLKTYLHTYESEI
NT seq 2589 nt   +upstreamnt  +downstreamnt
atggcaagacaaggctgtttcgggtcataccaggtaatatccttgttcacttttgccatc
ggcgtcaatctctgcttaggattcacagcaagtcgaattaagagggccgaatgggatgaa
ggacctcccacagtgttatctgactctccatggaccaacacatctggatcctgcaaaggt
agatgctttgagcttcaagaggttggacctcctgactgtcggtgtgacaacctatgtaag
agctacagcagctgctgccatgattttgatgagctctgtttgaaaacagctcgaggctgg
gagtgcaccaaagacagatgtggggaagtacgaaatgaggaaaatgcctgtcactgctca
gaagactgcttgtcccggggagactgctgtaccaactaccaagtggtctgcaaaggagaa
tcacactgggtagatgatgactgtgaagaaataagagtccccgaatgccctgcagggttt
gtccgccctccgttaatcatcttctctgtggatggattccgtgcatcgtacatgaagaaa
ggcagcaaggttatgcccaacattgagaaactgcggtcctgtggcacccatgctccctac
atgaggcctgtgtaccctacaaaaaccttccctaatctgtatacgctggccactggttta
tatccagaatcccatggaatcgttggcaattcaatgtatgaccctgtctttgatgctact
ttccatcttcgagggcgagagaagtttaaccatagatggtggggaggccaaccgctatgg
attacagccaccaagcaaggggtgagagccgggacattcttttggtctgtgagcatccct
cacgagcggagaatcctaactatccttcagtggctttccctgccagacaatgagaggcct
tcagtttatgccttctactccgagcagcctgatttttctggacacaagtacggccctttt
ggccctgagatgacaaatcctctgagggagattgacaagaccgtggggcagttaatggac
ggactgaaacaactcaagctgcaccgttgtgtgaatgttatctttgttggagaccatgga
atggaagacgtgacatgtgacagaactgagttcttgagcaactatctgactaacgtggat
gatattactttagtacctggaactctaggaagaattcgacccaagattcccaataatctt
aaatatgaccctaaagccattattgctaacctcacgtgtaaaaaaccagatcagcacttt
aagccttacatgaaacagcaccttcccaaacgtttgcactatgccaacaatcggagaatc
gaggatctccatttattggtggaacgcagatggcatgttgcaaggaaacctttggacgtt
tataagaagccgtcaggaaaatgttttttccagggtgaccacggctttgataacaaggtc
aatagcatgcagactgtttttgtaggttatggcccaacttttaagtacaggactaaagtg
cctccatttgaaaacattgaactttataatgttatgtgcgatctcctaggcttgaagcca
gctcccaataatggaacacatggaagtttgaatcacctgctacgcacaaatacctttagg
ccaaccctaccagaggaagtcagcagacccaattacccagggattatgtaccttcagtct
gattttgacctgggctgcacctgtgatgataaggtagagccaaagaacaaattggaagaa
ctaaataaacgccttcataccaaaggatctacagaagagagacatctcctgtatggacga
cctgcagtgctttatcggactagctatgatatcttataccatacggactttgaaagtggt
tacagtgaaatattcttaatgcctctctggacttcttataccatttctaagcaggctgag
gtctctagcatcccagagcacctgaccaactgtgttcgccctgatgtccgtgtatctcct
ggattcagtcagaactgtttagcctataaaaatgataaacagatgtcctatggattcctt
tttcctccctatctgagctcttccccagaagcgaaatatgatgcattccttgtaaccaac
atggttccaatgtaccctgccttcaaacgtgtttggacttatttccaaagggtcttggtg
aagaaatatgcgtcagaaaggaatggggtcaacgtaataagtggaccgatctttgactac
aattacaatggcttacgtgacattgaggatgaaattaaacagtatgtggaaggcagctct
attcctgtccctacccactactacagcatcatcaccagctgcctggacttcactcagcct
gcagacaagtgtgatggtcctctctctgtgtcttctttcatccttcctcaccgacctgac
aatgatgagagctgtaatagttccgaggatgagtcgaagtgggtagaggaactcatgaag
atgcacacagctcgggtgagggacatcgagcatctcaccggtttggatttctaccggaag
actagccgtagctattcggaaattctgaccctcaagacatacctgcatacatatgagagc
gagatttaa

DBGET integrated database retrieval system