KEGG   Mus musculus (mouse): 18607Help
Entry
18607             CDS       T01002                                 

Gene name
Pdpk1, Pdk1
Definition
(RefSeq) 3-phosphoinositide dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu03320  PPAR signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04210  Apoptosis
mmu04510  Focal adhesion
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04910  Insulin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04931  Insulin resistance
mmu04960  Aldosterone-regulated sodium reabsorption
mmu05145  Toxoplasmosis
mmu05160  Hepatitis C
mmu05205  Proteoglycans in cancer
mmu05213  Endometrial cancer
mmu05215  Prostate cancer
mmu05223  Non-small cell lung cancer
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    18607 (Pdpk1)
   04071 Sphingolipid signaling pathway
    18607 (Pdpk1)
   04151 PI3K-Akt signaling pathway
    18607 (Pdpk1)
   04152 AMPK signaling pathway
    18607 (Pdpk1)
   04150 mTOR signaling pathway
    18607 (Pdpk1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    18607 (Pdpk1)
  Cell growth and death
   04210 Apoptosis
    18607 (Pdpk1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    18607 (Pdpk1)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    18607 (Pdpk1)
   04664 Fc epsilon RI signaling pathway
    18607 (Pdpk1)
  Endocrine system
   04910 Insulin signaling pathway
    18607 (Pdpk1)
   03320 PPAR signaling pathway
    18607 (Pdpk1)
   04919 Thyroid hormone signaling pathway
    18607 (Pdpk1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    18607 (Pdpk1)
  Nervous system
   04722 Neurotrophin signaling pathway
    18607 (Pdpk1)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    18607 (Pdpk1)
   05205 Proteoglycans in cancer
    18607 (Pdpk1)
   05215 Prostate cancer
    18607 (Pdpk1)
   05213 Endometrial cancer
    18607 (Pdpk1)
   05223 Non-small cell lung cancer
    18607 (Pdpk1)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    18607 (Pdpk1)
  Infectious diseases
   05160 Hepatitis C
    18607 (Pdpk1)
   05145 Toxoplasmosis
    18607 (Pdpk1)
  Drug resistance
   01524 Platinum drug resistance
    18607 (Pdpk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18607 (Pdpk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   18607 (Pdpk1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    18607 (Pdpk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase PH_3 Pkinase_Tyr Kinase-like Haspin_kinase APH Kdo
Motif
Other DBs
NCBI-GeneID: 18607
NCBI-ProteinID: NP_035192
MGI: 1338068
Ensembl: ENSMUSG00000024122
Vega: OTTMUSG00000016280
UniProt: Q9Z2A0 Q3UGN6 Q3UHZ0
Position
17; 17 A3.3
AA seq 559 aa AA seqDB search
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRSQTEPGSSPGIPSGVSRQGSTMDGTTAEAR
PSTNPLQQHPAQLPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRH
IIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSF
DETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQA
RANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKL
EYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFETITWENLHQQTPPK
LTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHSLSTVETSLPQRSGSNIEQYIH
DLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLL
LTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCR
KIQEVWRQQYQSNPDAAVQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacgctgtgcccattcagtccagtgtggtgcta
tgttcctgcccatccccatcaatggtgaggtcccagactgagcccggttcgtcccctggc
attcctagtggtgttagcaggcagggatccaccatggatggcaccacagctgaagcccga
ccaagcaccaaccccttgcagcagcaccctgcccagctgccaccacagcctcgcaagaaa
cgccctgaagacttcaagtttgggaaaattcttggcgagggctctttttcaacagttgtt
ctggcccgagaactggccacttccagagaatatgctattaaaattctggagaaacgtcat
attataaaagaaaacaaagttccgtatgtaactagagagagagatgtgatgtcacgcctg
gatcaccccttctttgtgaaactttattttacatttcaggacgacgaaaagctgtatttt
ggccttagttatgccaaaaatggagagctacttaaatacatccgcaaaattggctcattt
gatgagacctgtacccggttttacacggctgagattgtgtctgctttagagtacttgcat
ggcaagggcatcattcacagagaccttaaaccagaaaacattttgttaaatgaagacatg
cacatccagatcacagattttggaacagcaaaagtgttatccccagagagcaaacaagcc
agggccaactcatttgtaggaacagcacagtatgtttctccagagctgctcacagagaag
tcggcgtgtaaaagttcagacctttgggcccttggatgtataatctatcagctcgtggca
ggactcccaccattcagagccgggaatgaatatcttatatttcagaagatcattaagctg
gaatatcatttcccagaaaaattcttccctaaggctagagatcttgtggaaaaactcttg
gttttagatgccacaaagcgtttaggctgtgaagagatggaagggtacgggcctctcaaa
gctcatccattctttgagaccatcacttgggagaatttgcaccagcagacacctccgaag
ctcacagcttacctaccagccatgtcagaggatgatgaagactgctatggcaactacgac
aatctcctgagccagtttggcttcatgcaggtgtcatcctcctcctcttcccactccctg
tctacggtggaaaccagcctgccccagaggtcgggcagcaacatagagcagtacatccat
gatttggacactaactcttttgaactagacttacagttttcagaagatgaaaaaaggttg
ttattggaaaagcaagccggtggaaacccttggcaccagtttgtagaaaataatctaata
ttaaaaatgggtccagtggataagcgaaagggtttatttgcaagacgacgacagttatta
ctcacagaagggccacatttatattatgttgatcctgtcaacaaggtcttgaaaggtgaa
atcccatggtcacaagaactccgaccagaagccaagaattttaaaactttctttgtccac
acgcctaacaggacgtactacctgatggatccaagcgggaatgctcacaagtggtgcaga
aagatccaggaggtttggaggcagcagtaccagagcaatccagatgctgctgtgcagtga

DBGET integrated database retrieval system