KEGG   Mus musculus (mouse): 18611Help
Entry
18611             CDS       T01002                                 

Gene name
Pea15a, Mat1, PEA-15, Pea15, Pkcs15
Definition
(RefSeq) phosphoprotein enriched in astrocytes 15A
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DED
Motif
Other DBs
NCBI-GeneID: 18611
NCBI-ProteinID: NP_001316798
MGI: 104799
Ensembl: ENSMUSG00000013698
Vega: OTTMUSG00000022139
UniProt: Q62048
Structure
PDB: 

Position
1 H3; 1 79.54 cM
AA seq 130 aa AA seqDB search
MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNL
SYIEHIFEISRRPDLLTMVVDYRTRVLKISEEEELDTKLTRIPSAKKYKDIIRQPSEEEI
IKLAPPPKKA
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtacggaactctccttcaggacctgaccaacaacatcacccttgaagatctg
gaacagctcaagtcagcctgcaaggaggacatccccagtgagaagagtgaggagatcacc
acaggcagtgcctggtttagcttcctggagagccacaacaagctggacaaagacaacctc
tcctacattgagcacatctttgagatatctcgccgtcctgacctcctcactatggtggtt
gactacagaacccgtgtgctgaagatctctgaggaggaggagctggacaccaagctaacc
cgtattcccagtgccaagaagtacaaagacattatccggcagccctctgaagaagaaatc
atcaaattggctcccccaccaaagaaggcctga

DBGET integrated database retrieval system