KEGG   Mus musculus (mouse): 18613
Entry
18613             CDS       T01002                                 

Gene name
Pecam1, C85791, Cd31, PECAM-1, Pecam
Definition
(RefSeq) platelet/endothelial cell adhesion molecule 1
  KO
K06471  platelet/endothelial cell adhesion molecule
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04670  Leukocyte transendothelial migration
mmu05144  Malaria
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    18613 (Pecam1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    18613 (Pecam1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    18613 (Pecam1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18613 (Pecam1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18613 (Pecam1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    18613 (Pecam1)
   04091 Lectins [BR:mmu04091]
    18613 (Pecam1)
CD molecules [BR:mmu04090]
 Proteins
  18613 (Pecam1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   18613 (Pecam1)
Lectins [BR:mmu04091]
 I-type lectins (Siglecs)
  18613 (Pecam1)
SSDB
Motif
Pfam: Ig_2 Ig_3 Ig_C17orf99 ig I-set Izumo-Ig MAP17 EVC2_like FixG_C
Other DBs
NCBI-GeneID: 18613
NCBI-ProteinID: NP_001292086
MGI: 97537
Ensembl: ENSMUSG00000020717
Vega: OTTMUSG00000003418
UniProt: Q08481
Position
11; 11 E1
AA seq 727 aa
MLLALGLTLVLYASLQAEENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQ
HRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGV
SKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLM
EFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQ
LHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRI
SKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQN
FSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISC
QSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEI
LRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVN
DTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKKGLIAVVVIGV
VIATLIVAAKCYFLRKAKAKQKPVEMSRPAAPLLNSNSEKISEPSVEANSHYGYDDVSGN
DAVKPINQNKDPQNMDVEYTEVEVSSLEPHQALGTRATETVYSEIRKVDPNLMENRYSRT
EGSLNGT
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgctcctggctctgggactcacgctggtgctctatgcaagcctccaggctgaggaaaac
tccttcaccatcaacagcatccatatggaaagcctgccatcatgggaggtgatgaatggg
cagcaactgaccctggagtgccttgtggacatcagcaccacctcgaaaagcaggtctcag
caccgggtgctgttctataaggacgatgcgatggtgtataacgtcacctccagggagcac
accgagagctacgtcattcctcaggctcgggtcttccactccgggaagtacaaatgcaca
gtgatgctgaacaacaaggaaaaaaccacgattgagtacgaggtgaaggtgcatggcgta
tccaagcccaaggtgacactggacaaaaaggaggtgacagaaggcggggtcgtgacggtc
aattgttccttgcaagaagaaaagccaccgatcttttttaaaattgaaaaattagaagtg
gggacaaagtttgtcaagcgaaggatagataagacctccaacgagaactttgtgctcatg
gaattccccattgaggcgcaggaccacgtgttagtgtttcgctgccaagctgggatcctg
tccggattcaaattgcaggagtcagaacccatcaggagtgaatacgtcaccgtgcaggag
tccttctccactcccaagtttgaaatcaagccccctgggatgatcatagaaggggaccag
ctgcacattaggtgcatagttcaagtgacacacttggtccaggagtttacagaaattatc
atccaaaaagacaaggcgattgtagccacctccaagcaaagcagtgaagctgtctactca
gtcatggccatggtcgagtacagtggacactacacctgcaaagtggaatcaaaccgtatc
tccaaagccagtagcatcatggtcaacataacagagctgtttcccaagccgaagttagag
ttctcctccagtcgtctggaccaaggggagttgttggacctgtcctgctccgtctcgggc
acacctgtagccaacttcaccatccagaaggaagagacggtcttgtcgcagtatcagaat
ttcagcaagatcgccgaggagagtgacagcggggagtacagctgtactgcaggcatcggc
aaagtggtcaagagaagcggcctggtaccgatccaggtgtgcgaaatgctctcgaagccc
agtatttttcatgatgccaagtctgagatcataaaaggacatgccataggcatcagctgc
cagtccgaaaatggaactgcacccatcacttaccaccttatgaaagcaaagagtgacttc
cagactctcgaggtgacctccaatgacccagcaacattcacagataagcccaccagagac
atggaataccagtgcagagcggataattgccattcccaccccgcggtgttcagcgagatc
ctgagggtcagggtgatagccccagtggatgaagttgtgatttccatcctgtcgagtaac
gaggtacagtctggaagtgaaatggtacttcggtgctctgtgaaagaggggacgagccca
atcacgtttcagttttacaaagaaaaggaggacagacccttccaccaagcggtcgtgaat
gacacccaagcgttttggcacaacaaacaagctagcaagaagcaggaaggacagtactac
tgtacagcctccaacagagccagcagtatgaggaccagtccccgaagcagcactcttgca
gtcagagtcttccttgccccatggaagaaagggctcattgcggtggttgtcattggagtg
gtcatcgccaccttaatagttgcagccaaatgctacttcctgaggaaagccaaggccaaa
cagaaacccgtggagatgtccaggccagctgctccacttctgaactccaacagcgagaag
atttctgagcctagtgtggaagccaacagccattacggttatgatgatgtttctggaaat
gatgcagtaaaacccataaatcaaaataaagacccccagaacatggatgtagaatacaca
gaagtggaagtgtcctcccttgagcctcaccaagctctgggaacgagagccacagagacg
gtgtacagtgagatccggaaggtcgaccctaatctcatggaaaacagatactctagaacg
gaaggctcccttaatggaacttaa

DBGET integrated database retrieval system