KEGG   Mus musculus (mouse): 18624
Entry
18624             CDS       T01002                                 

Symbol
Pepd, Pep-4, Pep4, dal
Name
(RefSeq) peptidase D
  KO
K14213  Xaa-Pro dipeptidase [EC:3.4.13.9]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    18624 (Pepd)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.9  Xaa-Pro dipeptidase
     18624 (Pepd)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M24
   18624 (Pepd)
SSDB
Motif
Pfam: Peptidase_M24 AMP_N
Other DBs
NCBI-GeneID: 18624
NCBI-ProteinID: NP_032846
MGI: 97542
Ensembl: ENSMUSG00000063931
Vega: OTTMUSG00000031826
UniProt: Q11136 A2RS23
Position
7 B2; 7 20.7 cM
AA seq 493 aa
MASTVRPSFSLGNETLKVPLALFALNRQRLCERLRKNGAVQAASAVVLQGGEEMQRYCTD
TSIIFRQESFFHWAFGVVESGCYGVIDVDTGKSTLFVPRLPDSYATWMGKIHSKEYFKEK
YAVDDVQYTDEIASVLTSRNPSVLLTLRGVNTDSGSVCREASFEGISKFNVNNTILHPEI
VECRVFKTDMELEVLRYTNRISSEAHREVMKAVKVGMKEYEMESLFQHYCYSRGGMRHTS
YTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGEYYCFASDITCSFPANGKFTE
DQKAIYEAVLRSCRTVMSTMKPGVWWPDMHRLADRIHLEELARIGLLSGSVDAMLQVHLG
AVFMPHGLGHFLGLDVHDVGGYPEGVERIDEPGLRSLRTARHLEPGMVLTVEPGIYFIDH
LLDQALADPAQACFFNQEVLQRFRNFGGVRIEEDVVVTDSGMELLTCVPRTVEEIEACMA
GCDKASVPFSGQK
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggcgtccactgtgcgcccttccttctccctggggaatgagaccctgaaggtgccactg
gcactattcgccctgaacaggcagcgcctgtgtgagaggctgaggaagaatggagctgta
caggccgcctcagctgtcgtgttgcagggcggggaagagatgcaacggtactgcaccgat
acctccatcatcttccgccaggagtccttctttcactgggccttcggtgtcgtcgagtca
ggctgctatggtgtcatcgatgtggacactggaaaatcaaccctgtttgtgcccaggctt
cctgatagctacgccacctggatgggaaagatccattccaaggagtatttcaaggagaag
tacgctgtggatgatgtccagtacacggatgagattgccagtgtcctgacctcacggaac
ccctctgtcctcctcactttgcgcggtgtcaacacagacagtggcagtgtctgcagggag
gcctccttcgagggcattagcaagttcaatgtcaacaacacgattcttcacccagagatc
gtggaatgccgagtgttcaagacagacatggaactagaggttttgcgctacacaaatcgg
atctccagcgaggcccaccgtgaggtaatgaaggctgtaaaagtggggatgaaggaatac
gagatggaaagcctgttccagcattattgttactctaggggcggcatgcgccacacctct
tacacctgtatctgctgtagcggtgagaacgcggccgtgctgcactatggccatgctgga
gcccccaatgaccggacgatcaaggatggagatatttgcctgttcgacatgggtggcgag
tactactgctttgcttctgacatcacctgctccttcccagccaacggcaagttcacagag
gaccagaaggccatctacgaagcagtgctcaggagctgcagaactgtcatgagcactatg
aagccaggggtctggtggcctgatatgcatcggctggctgaccgtatccacctggaggaa
ctggcacgcattggcctcctgagtggcagtgtggatgccatgctccaggtccacctggga
gcagtattcatgccacatggacttggccactttctgggcctagatgtgcacgacgtggga
ggctaccctgagggtgtagagcgcatcgatgaacctggcctgcgaagcctgcgtacggca
aggcacctggagccgggcatggtgctgactgtggagccaggcatctacttcattgaccac
ctcttggaccaggccctggcagacccggcccaagcctgcttctttaaccaagaggtcctg
cagcgcttccgcaacttcggtggggtgcggatcgaggaagatgttgtcgtgactgacagc
ggcatggagctgctgacatgtgtaccccggactgtggaggaaatcgaagcgtgcatggca
ggctgcgacaaggcatctgtgcccttctctggccaaaagtag

DBGET integrated database retrieval system