KEGG   Mus musculus (mouse): 18626
Entry
18626             CDS       T01002                                 

Gene name
Per1, Hftm, Per, m-ri, m-rigui, mPe, mPer1
Definition
(RefSeq) period circadian clock 1
  KO
K21944  period circadian protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04710  Circadian rhythm
mmu04713  Circadian entrainment
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    18626 (Per1)
   04713 Circadian entrainment
    18626 (Per1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18626 (Per1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    18626 (Per1)
Motif
Pfam: Period_C PAS_3 PAS_11 PAS DUF4698
Other DBs
NCBI-GeneID: 18626
NCBI-ProteinID: NP_001152839
MGI: 1098283
Ensembl: ENSMUSG00000020893
Vega: OTTMUSG00000005970
UniProt: O35973
Structure
PDB: 
4DJ2

Position
11; 11 B3
AA seq 1291 aa
MSGPLEGADGGGDPRPGEPFCPGGVPSPGAPQHRPCPGPSLADDTDANSNGSSGNESNGP
ESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPS
TSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQE
YYQQWSLEEGEPCAMDMSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGV
LLRCKRDVFRGARFSELLAPQDVGVFYGSTTPSRLPTWGTGTSAGSGLKDFTQEKSVFCR
IRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIF
TTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPF
DHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAP
SLDSDIQELSEQIHRLLLQPVHSSSPTGLCGVGPLMSPGPLHSPGSSSDSNGGDAEGPGP
PAPVTFQQICKDVHLVKHQGQQLFIESRAKPPPRPRLLATGTFKAKVLPCQSPNPELEVA
PVPDQASLALAPEEPERKETSGCSYQQINCLDSILRYLESCNIPSTTKRKCASSSSYTAS
SASDDDKQRAGPVPVGAKKDPSSAMLSGEGATPRKEPVVGGTLSPLALANKAESVVSVTS
QCSFSSTIVHVGDKKPPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPTPDAYRPVGLTK
AVLSLHTQKEEQAFLNRFRDLGRLRGLDTSSVAPSAPGCHHGPIPPGRRHHCRSKAKRSR
HHHHQTPRPETPCYVSHPSPVPSSGPWPPPPATTPFPAMVQPYPLPVFSPRGGPQPLPPA
PTSVSPATFPSPLVTPMVALVLPNYLFPTPPSYPYGVSQAPVEGPPTPASHSPSPSLPPP
PLSPPHRPDSPLFNSRCSSPLQLNLLQLEESPRTEGGAAAGGPGSSAGPLPPSEETAEPE
ARLVEVTESSNQDALSGSSDLLELLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGGST
SASITRSSQSSHTSKYFGSIDSSEAEAGAARARTEPGDQVIKCVLQDPIWLLMANADQRV
MMTYQVPSRDAASVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPRALDVTA
CVDCGSSVQDPGHSDDPLFSELDGLGLEPMEEGGGEGGGCGVGGGGGDGGEEAQTQIGAK
GSSSQDSAMEEEEQGGGSSSPALPAEENSTS
NT seq 3876 nt   +upstreamnt  +downstreamnt
atgagtggtcccctagaaggggccgatgggggaggagaccccaggcccggagaacctttt
tgtcctggaggagtcccatcccctggggccccgcagcaccggccttgtccaggccccagc
ctggctgatgacactgatgcaaacagcaatggctcaagtggcaatgagtccaacggaccc
gagtccaggggcgcatctcagcggagttctcatagttcctcttctggcaatggcaaggac
tcagctctgctggagaccactgagagcagcaagagtacaaactcacagagcccatcccca
cccagcagctccattgcctacagcctcctgagtgcgagctcagagcaggacaacccatct
accagtggctgcagcagtgaacagtcagctcgagccaggacccagaaagaactcatgact
gcacttcgggagctcaaacttcgactgccaccagagcgtcggggcaagggccgctctggg
accttggccacactgcagtacgctctggcctgtgtcaagcaggttcaggctaaccaggaa
tattaccagcagtggagtctggaggagggtgagccttgtgccatggacatgtctacttac
accctggaggaattggagcatatcacatccgaatacacacttcgaaaccaggacaccttc
tctgtggctgtgtccttcctgacaggccggattgtctatatttcggagcaggcaggtgtc
ctgctgcgttgcaaacgggatgtgtttcggggtgcccgcttctcagagctcctggctccc
caggatgtgggtgtcttctatggctctactacaccatctcgactgcccacctggggcact
ggcacctctgcaggttcaggtctcaaggacttcacccaggaaaagtctgtcttctgccga
atcagaggaggtcctgaccgggatccagggcctcggtaccagccattccgcctaacccca
tatgtgaccaagattcgggtctcagatggagcccctgcacagccgtgctgcctactcatt
gccgagcgcatccactctggttatgaagctccccggatccctcctgacaagaggatcttc
accacccgacacacaccaagctgcctcttccaggatgtagatgaaagggctgccccactg
ctgggttaccttccccaggatctcctgggggctccagtacttctctttctacatcctgag
gaccgacccctcatgctggccattcataagaagatactgcagctggcaggccagcccttt
gaccattcccctattcgcttctgtgctcggaacggggaatatgtcaccatggacaccagc
tgggccggttttgtgcacccctggagccgcaaggtggctttcgtgttgggtcgccataaa
gtgcgcacggcacccctgaatgaggacgtcttcactcccccagcccccagcccagctccg
tccctggactctgatatccaggagctctcagagcagatccatcgattgctgctgcagcct
gtgcacagctccagccccacggggctctgtggagttggccctctgatgtcccctggtcct
ctacacagccctggctcctccagtgatagcaatgggggggacgctgaggggcctgggcct
cctgctccagtgactttccagcagatctgtaaggatgtgcatctggtaaagcaccaggga
caacagctcttcattgaatctcgggccaagcccccaccccggccccgcctccttgctaca
ggtacattcaaagccaaagtccttccctgccagtccccaaaccccgaactggaggtggcc
ccagttcctgaccaagcctcgttagccttggcccctgaggagccagagaggaaagaaacc
tctggctgttcctaccagcagatcaactgcctggacagcatcctcaggtatttggagagc
tgcaacattcccagtacaaccaagcgtaaatgtgcctcctcctcctcctacactgcctct
tcagcctctgatgatgacaagcagagggcaggtccagttcctgtgggggccaagaaagat
ccgtcgtcagcaatgctgtctggggagggggcaactcctcggaaggagccagtggtggga
ggcaccctgagcccgctcgccctggccaataaggcagagagcgtggtgtccgtcaccagt
cagtgtagcttcagctccaccatcgtccatgtgggagacaagaagcccccggagtcggac
atcatcatgatggaagacctgcctggcctggcccctggcccagcccccagtccggccccc
agccccacagtagcccctgacccaaccccagatgcttatcgcccagtgggtctgaccaag
gccgtgctgtccctgcacacacagaaggaagagcaagccttcctcaaccgcttcagagat
cttggcaggcttcgtggacttgacacctcttctgtggccccctcagcccctggctgccac
catggccccattccccctggtcgccgacaccactgccgatctaaagcaaagcgttcccgc
caccaccaccaccagaccccccggcccgaaactccctgctatgtctcccatccttcacct
gtgccctcttctggaccctggccacccccaccagccacgacccccttcccagcaatggtc
cagccctacccactcccagtattctcccctcgaggaggaccccagccccttccccctgcc
cctacatctgtgtcccctgctaccttcccttctcccttagtgaccccaatggtggccttg
gtgctccctaactatctattccctaccccacctagttatccatatggggtgtcccaggcc
cctgttgaggggccacccacgcctgcttcccactcgccctctccatccctgcccccacca
cctctcagccccccccaccgcccagactccccactgttcaactcgagatgcagctcccca
ctccagctcaatctgctgcagcttgaggagtccccccgcacggaggggggcgctgctgca
ggaggcccaggaagcagtgctgggcccctgcctcccagtgaggagactgctgagccagag
gccagattggtggaggttactgagtcgtccaatcaggatgcactttcaggctccagcgac
ctgctggagctactgctccaagaagactctcgctcgggcacaggctccgcagcctcaggc
tccctgggctctggcctgggctctgggtctggttcaggatcccacgaagggggaagcacc
tcagccagcatcacccgcagcagtcagagcagccatacaagcaagtactttggcagcatc
gactcttccgaggctgaagctggggctgctcgggccaggactgagcctggggaccaggtc
attaagtgtgtgctccaggaccccatctggctgctcatggccaatgccgaccagcgtgtc
atgatgacataccaggtgccgtccagggatgcagcctctgtgctgaagcaagaccgggag
aggctccgggccatgcagaaacagcagccacggttctcagaggaccagaggcgggaactg
ggtgctgtgcactcctgggtccggaagggccagctgcctcgggcccttgatgtgacggcg
tgtgtggactgtggcagcagcgttcaagatcctggccactctgatgaccccctcttctca
gaactggatggattggggctggagcccatggaagagggtggaggcgagggtggtgggtgt
ggtgttggcggtggtgggggtgatggtggtgaggaggcccagacccaaattggggctaag
ggttcaagctctcaggactctgccatggaggaagaagagcaaggtgggggctcatccagc
ccagctttacctgcagaagaaaacagcaccagctag

DBGET integrated database retrieval system