KEGG   Mus musculus (house mouse): 18628
Entry
18628             CDS       T01002                                 
Symbol
Per3, 2810049O06Rik, mPer3
Name
(RefSeq) period circadian clock 3
  KO
K21945  period circadian protein 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
mmu04713  Circadian entrainment
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    18628 (Per3)
   04713 Circadian entrainment
    18628 (Per3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18628 (Per3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    18628 (Per3)
SSDB
Motif
Pfam: Per3-like_PAS-A Period_C PAS_3 PAS_11 PAS
Other DBs
NCBI-GeneID: 18628
NCBI-ProteinID: NP_035197
MGI: 1277134
Ensembl: ENSMUSG00000028957
UniProt: O70361
Position
4:complement(151081475..151129167)
AA seq 1113 aa
MDPCGDPAVPGGDCPQTRGPGLQGASGQEGPLQGTCVDSSHSEHEDRNRMSEELIMVVQE
MKKYFPAERHTKPSTLDALNYALRCVHSVQANSDFFQSLGPRGAHQADVTVYSLEDLTAL
ASEHTSKNTDTFAAVFSFLSGRLVHISEQAALILNSKRGFLKSVHFVDLLAPQDVRAFYA
HTAPTQLPFWNNWTQRASQYECAPAKPFFCRICGGGDREKRHYSPFRILPYLVHVHSSAQ
PEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVFLEVDERAVPLLGYLPQDLIG
TSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSPVRFCTQNGEYVILDSSWSSFVNPWS
RKVSFIIGRHKVRTSPLNEDVFATRIKKAASNDKDIAELQEQIHKLLLQPVHASASSGYG
SLGSSGSQEQHVSITSSSESSGHCPEEGQHEQMTLQQVYASVNKIKNVGQQLYIESMARS
SVKPVAETCVEPQGGDEQKDFSSSQTLKNKSTTDTGSGGNLQQEQPSSSYQQMNCIDSVI
RYLTSYSLPALKRKCISCTNTSSSSEEAKPIPEVDSSQRDTEQLLDIRKQETTGPSTDIE
GGAARTLSTAALSVASGISQCSCSSTSGHAPPLQSESVAVACKPWALRTKASHLAAGGFK
HVGLTAAVLSAHTQKEEQNYVDRFREKILTSPYGCYLQQESRNRAQYSCVQAGSTAKHSR
CAGSERQKHKRKKLPAPVDTSSPGAHLCPHVTGLLPDEQHWGPSASPSPLGAGLAFPSAL
VVPSQTPYLLPSFPLQDMASQGVGVSAAWGAAAGCPPLSAGPQAVAAFPSAYVDTLMTIF
LHNAPLFPLWPPSFSPYPSLGAAGSSELAPLVPAMAPNPEPTTSGHSQRRVEENWEAHSE
ELPFISSRSSSPLQLNLLQEEMPAPSESADAVRRGAGPDAKHHCVTGPSGSRSRHCTSGE
LATATAQQESAAASGSSASSIYFSSTDYASEVSENRQRPQDRQRDEALPGAAEESIWRMI
ERTPECVLMTYQVPERGREEVLKQDLEKLQSMEQQQPLFSPAQREELAKVRSWIHSHTAP
QEGHLQSCVACEDRGSVGDTAEVLEQHPAEDTS
NT seq 3342 nt   +upstreamnt  +downstreamnt
atggatccctgtggagacccggcagtacctggtggcgactgtccccagactaggggaccg
gggctccagggggcgtctggccaggagggtcctctgcagggcacttgcgtggacagcagc
cacagtgaacacgaagaccgaaacagaatgtctgaagagcttataatggttgtccaagaa
atgaaaaagtatttcccagccgagaggcacactaagcccagtaccctagatgctcttaac
tatgccctgcgctgtgtacacagtgtgcaagcaaacagtgactttttccagagtctcggt
ccacgcggagcacaccaggcagatgtgactgtatacagtcttgaggacctcaccgctctg
gcttctgaacatacttctaagaacacagataccttcgcggccgtgttttcgtttctgtct
ggaaggttagtgcacatttctgagcaggctgctttgatcctgaattctaagaggggtttc
ctcaagagcgtgcactttgtcgacctgcttgcccctcaagacgtgagggcgttctacgcg
cacactgctccaactcagcttcctttctggaacaactggacccaaagagcctcgcagtat
gaatgtgcaccagcgaaaccctttttctgcagaatctgtggaggtggagacagagagaag
aggcattactccccattccggatcctcccctatttggttcatgtacatagctctgcccag
ccagaaccagagccttgctgtctaacactggttgaaaagattcactctggttacgaagct
cctcgaatccctgtagataaaagaatttttaccacaacacacactccaggatgtgtgttt
cttgaagtagatgaaagagcagtgcctttgctgggttacctacctcaggatctgattgga
acatcgatcttaacatacttgcacccagaagatcggcctctgatggttgccatacaccaa
aaagttttaaagtatgccggccaccctccgtttgaacactcgcccgtcagattctgcact
cagaacggagagtatgtcattctggattccagctggtccagctttgtcaacccctggagc
cggaaggtctccttcatcattggtcgacataaagtccgaacgagtccattaaatgaagat
gtttttgccaccagaataaaaaaggcagccagtaacgacaaagacatagcagaattacaa
gaacaaattcacaaacttctcttgcagccggttcatgctagtgcttccagtggctacggg
agcctgggcagcagcggctcacaggagcagcacgtcagcatcacctcttcgagtgagtcc
agcgggcactgtccggaggaaggccagcatgagcagatgaccctgcagcaggtctatgcc
agtgtaaacaaaattaagaatgtgggccaacagctctacatcgagtccatggccagatca
tcagtgaagccagtggcagagacgtgcgtggaaccgcagggtggtgatgagcagaaggac
ttttcttcctctcagacactgaaaaataaaagcaccacggatactggctccggtggcaat
ctgcagcaagagcagcccagctcgtcctatcagcagatgaactgtatcgacagtgtcatc
aggtacctgacaagctacagcctcccggccttgaaaagaaagtgcatctcctgcacaaac
acatcttcatcctcagaagaagccaagccaatcccggaggtggacagcagccagagagac
acggaacagctcctggacatacggaaacaggaaacaactggaccatccacagacatcgaa
ggaggtgctgctcggaccctgtccaccgccgcactgagcgtggcgtctggcatcagccag
tgcagctgcagcagcacctctggccacgctccgcccctacagtcagaaagtgttgccgtg
gcgtgtaagccgtgggccctgagaacgaaggcctctcacctggctgcaggaggatttaag
cacgtggggctcacagcagctgtcctctctgcacacacacagaaggaagagcagaactac
gttgacaggttccgggaaaagatcctgacctcgccctacggttgctatcttcagcaagag
agcagaaaccgtgctcagtactcctgtgttcaagcagggtccactgctaagcacagcaga
tgtgctggaagcgagaggcagaagcacaaacgaaagaagttgccagcacctgtggacacc
agcagccccggtgcccacctctgtccccatgtcacaggactcctcccggatgagcagcac
tggggcccatccgctagcccctcccccctcggcgcaggcttagcattcccctcggccctg
gtagttcccagccagaccccttatctcctcccctcttttcccctccaagatatggcctct
cagggagtgggggtctcggcagcctggggagctgcagccggatgtccacctctgtccgcc
ggcccccaggctgttgccgcgttcccctccgcttacgtggatactttgatgaccatcttc
ctgcacaacgcccctctcttccctctgtggccgccctcgttctccccatacccatccctg
ggggccgcagggtcttctgaactggcacccttagtaccagcaatggctccaaacccggaa
ccaaccacttcaggccacagccaaaggagagtggaggagaactgggaggcacacagtgaa
gagcttccgttcattagctcacggagcagttcaccgttacagttaaatttactccaggaa
gaaatgcctgcgccgtcagagtccgcagacgcagtgagaagaggcgctgggccagacgct
aagcatcactgtgttacaggtcccagtggcagtaggagccgtcactgcacctctggtgag
ctggccacggcaacagcgcagcaggagtctgctgctgcctcaggaagcagtgccagcagt
atatacttcagtagcactgactatgcttctgaagtctctgaaaacagacagaggccacag
gatagacagagagacgaagcccttcccggggcggctgaagagtccatctggagaatgata
gagcggacaccagagtgtgttctcatgacataccaggtgcccgagaggggtcgagaggag
gtgctgaagcaggacctggagaagctccagagcatggaacagcagcagcccctgttctct
cccgcgcagagggaggagctggccaaggtgcgctcctggatccacagccacacagcccct
caggagggacacctccagagctgtgtcgcctgtgaagacagaggttcagtgggtgacact
gcagaggtcctggaacagcacccagcagaagacaccagttga

DBGET integrated database retrieval system