KEGG   Mus musculus (mouse): 18631
Entry
18631             CDS       T01002                                 

Gene name
Pex11a, PEX11, PEX11alpha
Definition
(RefSeq) peroxisomal biogenesis factor 11 alpha
  KO
K13351  peroxin-11A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    18631 (Pex11a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    18631 (Pex11a)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   18631 (Pex11a)
SSDB
Motif
Pfam: PEX11
Other DBs
NCBI-GeneID: 18631
NCBI-ProteinID: NP_035198
MGI: 1338788
Ensembl: ENSMUSG00000030545
Vega: OTTMUSG00000024967
UniProt: Q9Z211
Position
7; 7 D2
AA seq 246 aa
MDAFIRVANQSQGRDRLFRATQHACMLLRYLLESKADKEAVVLKLKRLETSVSTGRKWFR
LGNVFHAIQATEQSIQAADLAPRLCLTLANLNRVVYYICDTVLWAKSVGLTSGVNREKWQ
RWAARHYYYFLLLSLVRDLYEILLQMGQVARDRAKREKSSRDPPKYSVANEETEWLQSFL
LLLFQSLKRHPPLLLDTVKNFCDILIPLNQLGIYKSNLGVVGLGGLISSLAGLLTVVYPQ
LKLKAR
NT seq 741 nt   +upstreamnt  +downstreamnt
atggacgccttcatccgagtcgccaaccaaagccagggccgggaccgacttttcagagcc
actcagcacgcatgcatgttgcttagatatttgttagagtctaaagctgacaaagaggcc
gtggtactgaagctcaagaggctggagaccagtgtgagcactggccgtaaatggttcaga
ctgggcaacgtgttccatgccatccaggcaactgagcagagcatccaagccgctgacctc
gcgccccgcttatgcctgacattagccaacctcaaccgcgtggtttattacatctgtgac
actgtcctctgggcgaagagtgtgggtcttacctctggagtcaacagagagaaatggcaa
aggtgggcggctcgccattactactacttcctcttgctgagcctggtccgggatctgtat
gagatcttgctgcagatgggacaagttgcacgtgacagagcaaagagagagaaatcctct
cgggaccctcctaagtacagcgtggctaatgaagagactgaatggctccagtccttcctc
ctcctcctattccagtctctaaagcgacatcctcccttgctcctggacaccgtgaagaac
ttctgtgacatcctgatccctctgaaccagcttgggatctacaagtccaatctcggcgtg
gtaggacttggaggtctcatatcctctttggctggtctcctcacggtagtgtatcctcag
ctgaaactgaaggcccgctag

KEGG   Mus musculus (mouse): 18632
Entry
18632             CDS       T01002                                 

Gene name
Pex11b, PEX11beta, Pex11pbeta
Definition
(RefSeq) peroxisomal biogenesis factor 11 beta
  KO
K13352  peroxin-11B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    18632 (Pex11b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    18632 (Pex11b)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   18632 (Pex11b)
SSDB
Motif
Pfam: PEX11
Other DBs
NCBI-GeneID: 18632
NCBI-ProteinID: NP_001155859
MGI: 1338882
Ensembl: ENSMUSG00000028102
Vega: OTTMUSG00000029574
UniProt: Q9Z210
Position
3; 3 F2.1
AA seq 259 aa
MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLEGHLSLGRKLLR
LGNSTDALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA
QRSFRYYLFSLIMNLSRDAYEIRLLMEQETSAYSRRMKVSGVGVSGGVETVGPGGPGTPG
GSLPQLALKFRLRILLLARVLRGHPPLLLDVLRNACDLFIPLDKLGLWRCGPGIVGLCGL
ISSILSILTLICPWLRLKP
NT seq 780 nt   +upstreamnt  +downstreamnt
atggacgcctgggtccgcttcagtgctcagagccaagcccgggagcggctgtgtagggcc
gcccagtatgcctgttcccttctcggccatgctttgcagagacatggggctagtcccgag
ttacagaaacagattcgacaactggagggtcatctgagcctcggacgaaagttgctacgc
ctggggaactcaacagatgccctggagtcagccaaaagggctgtgcacctgtcagatgtc
gttctgagattctgcatcactgtcagtcacctcaaccgagccttgtactttgcctgtgac
aatgtcctatgggctggaaagtctgggctagctccccgagtggaccaggaaaagtgggca
cagcgttcattcagatactatctgttttccctcatcatgaatctgagccgtgatgcttat
gagattcgcctattgatggaacaagagacttcagcttacagcaggcgaatgaaggtttct
ggagtaggagtctcaggaggagtagaaactgtgggacctggaggaccagggactccagga
ggaagtctgccacaactggctttgaagtttcggctccgaatcctgctactggctcgtgtc
cttcgaggtcatccccctctcttgctggatgtgctcagaaatgcctgtgaccttttcatc
ccactggacaaactaggcctctggcgttgtggccctgggattgtggggctgtgtggcctc
atatcctccattctgtctattctcaccctaatctgtccctggctacgactcaagccctga

KEGG   Mus musculus (mouse): 69129
Entry
69129             CDS       T01002                                 

Gene name
Pex11g, 1810022F11Rik, 1810049N02Rik, Pex11, Pex11c, Pex11ga, Pex11gamma
Definition
(RefSeq) peroxisomal biogenesis factor 11 gamma
  KO
K13353  peroxin-11C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    69129 (Pex11g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    69129 (Pex11g)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   69129 (Pex11g)
SSDB
Motif
Pfam: PEX11 Acyl_transf_3
Other DBs
NCBI-GeneID: 69129
NCBI-ProteinID: NP_081227
MGI: 1920905
Ensembl: ENSMUSG00000069633
Vega: OTTMUSG00000030750
UniProt: Q6P6M5
Position
8; 8 A1.1
AA seq 241 aa
MALLNRLASALESHRVRDRLIRTLGYCCQLIGGVLVEQCPNRSEVGRRLLVVSAQFNHCR
TVLRLFDDLAMFVYTKQYGLGTKEEDIFIRWLSVLSNVTDQLYYPCEHIAWAADAKVLRV
DSAWWWTLNTALWTLSLLLGAVKALWTMLKLRQKLRSPTGTSASQLPRSKRRAMEARICS
EVLTLLSNLADLANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSTCQAVRAGRQAEADS
P
NT seq 726 nt   +upstreamnt  +downstreamnt
atggctctgctgaaccgtctggcttccgcgctggagtcccaccgggtccgggaccgcctg
atccggacactggggtattgctgccagctgatcggtggggtcctagtggaacaatgcccc
aacaggtccgaagtgggaaggcgcttgctggtggtgtcagcccagttcaatcattgcagg
actgtcttgagactctttgatgacctggccatgtttgtctacactaagcagtatggcctg
ggaacaaaggaggaggacatcttcatccgatggctgtctgtcctgagtaatgtgactgac
caactgtactatccttgtgagcatatcgcctgggctgccgatgccaaggtcctccgggtg
gactctgcttggtggtggacactgaacacagccctctggactctctctctacttcttgga
gctgtcaaggccctgtggacaatgctgaagcttagacagaagctgcggagccccacaggc
acctctgcaagccagctgcccaggagcaagcggagggccatggaggcaaggatatgctca
gaggttttaactctactcagcaacctggctgacctggcaaatgctgtgcactggttgccc
cgaggtgtcctgtgggctggccgcttccctccttggctggtgggtctcatgggcaccatc
tcctccatcctcagcacatgccaagctgtcagggctggcagacaggccgaggcagacagc
ccttga

DBGET integrated database retrieval system