KEGG   Mus musculus (mouse): 18633
Entry
18633             CDS       T01002                                 

Gene name
Pex16
Definition
(RefSeq) peroxisomal biogenesis factor 16
  KO
K13335  peroxin-16
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    18633 (Pex16)
SSDB
Motif
Pfam: Pex16
Other DBs
NCBI-GeneID: 18633
NCBI-ProteinID: NP_660104
MGI: 1338829
Ensembl: ENSMUSG00000027222
Vega: OTTMUSG00000014473
UniProt: Q91XC9
Position
2; 2 E1
AA seq 336 aa
MEKLRLLSLRYQEYVTRHPAATAQLETAVRGLSYLLAGRFSDSHELSELVYSASNLLVLL
NDGILRKELRKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALIQLAK
AVLRMLLLIWFKAGIQTSPPIVPLDRETQAQPLDGDHNPGSQEPSYVGKRSHRVVRTLQN
SPSLHSRYWGAPQQREIRQKQQQEELSTPPTPLGLQETIAESLYIARPLLHLLSLGLWGQ
RSWTPWLLSGVVDMTSLSLLSDRKNLTRRERLELRRRTILLLYYLLRSPFYDRFSEAKIL
FLLQLLTDHIPGVGLVARPLMDYLPSWQKIYFYSWG
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggagaagctacggctcctgagcctccgctaccaggagtatgtgactcgtcatccagcc
gccacggcccagttggagacggctgtgcggggcctcagttacctgctggcaggtcgcttc
tccgattcacacgagctgtctgaactggtgtactctgcctcgaacctgctggtgctgctc
aatgacgggatcctgaggaaggagcttcgaaaaaagttgcctgtgtcgctgtcccagcag
aagttgctgacatggctgagtgtactggagtgtgtggaggtgttcatggagatgggggct
gccaaggtgtggggcgaagtaggccgttggctcgtcattgctctcatccagttggccaag
gccgtcctgcgcatgctcctgttgatctggttcaaggctggcattcagacatcacccccc
attgttccactggacagggaaactcaggcacagcccttggatggtgaccacaatccgggc
agccaggagccatcatatgtggggaaacggtcacacagagtggtgcgaaccctccagaac
agcccatccctgcactcacggtactggggagcccctcagcagcgggaaattcggcagaaa
cagcagcaggaggaactgagcacacccccaacacctctggggttgcaggagaccattgca
gagtctttgtacatcgcccggcccctgctgcacttgctcagcctgggcttatggggtcag
cgatcgtggacaccctggctactgtctggtgtggtagatatgactagcctgagtctcctg
agtgacaggaagaacttgacccggagggagcggctagaactgaggcgtcgcacaatcctg
ctgctatactacctgctacgctcaccgttctatgaccgcttctctgaagccaagatcctc
ttcctgctccagctgcttacagaccacatccctggcgtgggtctggtggcaaggccgctc
atggactacttgccctcctggcagaaaatctatttctacagttggggctga

DBGET integrated database retrieval system